Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036030 (Prtg)
Chromosomal location
Chr 9: 72655018 - 72761965 (+)
Description
protogenin homolog (Gallus gallus) Gene [Source:MGI Symbol;Acc:MGI:2444710]
RefSeq_dna
NM_175485 
RefSeq_peptide
NP_780694.3 
UniGene
Mm.31696 
MGI
MGI:2444710 
Uniprot/SWISSPROT
Q2EY15 
Human Ortholog
ENSG00000166450 (PRTG)
Omim not available
UniTrap UNI16842
Vector Insertion
Chr 9: 72655340 - 72657261
Public Clones IST14425A1 (tigm) IST14231B6 (tigm) IST13719G2 (tigm) IST14271A1 (tigm)
IST14121F10 (tigm) IST10245C4 (tigm) IST10481H5 (tigm)
Private Clones OST453392 (lexicon) OST361099 (lexicon) OST168167 (lexicon) OST135254 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17261
Vector Insertion
Chr 9: 72657565 - 72690501
Public Clones (ggtc) IST13334B6 (tigm) IST10865E5 (tigm) IST11779F11 (tigm) IST12839B5 (tigm)
IST13331C12 (tigm) IST14877D12 (tigm) IST13832A3 (tigm) IST11963E8 (tigm)
IST10806A3 (tigm) IST14495D2 (tigm) IST14239C11 (tigm) IST12586F1 (tigm)
IST10143A2 (tigm) IST14128F4 (tigm) IST14746F6 (tigm) IST12419A6 (tigm)
IST10070F6 (tigm) IST13883D12 (tigm) IST11109C4 (tigm) IST15112F8 (tigm)
IST10827G6 (tigm) IST12135F12 (tigm) IST11983D10 (tigm) IST13826G10 (tigm)
IST13588E8 (tigm) IST10970B2 (tigm) IST12091B4 (tigm) IST11385D9 (tigm)
IST12843A7 (tigm) IST11042C7 (tigm) IST14936B2 (tigm) IST12679C8 (tigm)
IST14276B9 (tigm) IST13677D3 (tigm) IST13643D6 (tigm) IST12915F11 (tigm)
IST14413E5 (tigm) IST14559H5 (tigm) IST12778G8 (tigm) IST12500B9 (tigm)
IST14226A4 (tigm) IST15019C6 (tigm) IST10246E10 (tigm) IST12203H10 (tigm)
IST13967C3 (tigm) IST12706F9 (tigm) IST14785D7 (tigm) IST11940H10 (tigm)
IST14162D11 (tigm) IST13888D7 (tigm)
Private Clones OST446512 (lexicon) OST441517 (lexicon) OST423980 (lexicon) OST354037 (lexicon)
OST338818 (lexicon) OST338531 (lexicon) OST303701 (lexicon) OST300626 (lexicon)
OST300359 (lexicon) OST293498 (lexicon) OST288089 (lexicon) OST278969 (lexicon)
OST278541 (lexicon) OST272137 (lexicon) OST249232 (lexicon) OST248936 (lexicon)
OST193348 (lexicon) OST187636 (lexicon) OST166778 (lexicon) OST139244 (lexicon)
OST134034 (lexicon) OST132173 (lexicon) OST130258 (lexicon) OST124113 (lexicon)
OST110589 (lexicon) OST97949 (lexicon) OST45714 (lexicon) OST38511 (lexicon)
OST38395 (lexicon) OST37838 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13027
Vector Insertion
Chr 9: 72706757 - 72738583
Public Clones CMHD-GT_338E6-3 (cmhd) IST10012H1 (tigm) IST14778C2 (tigm) IST12027C9 (tigm)
IST14413C4 (tigm) IST13616G4 (tigm) IST13633D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26599
Vector Insertion
Chr 9: 72738680 - 72739615
Public Clones not available
Private Clones OST108617 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15781
Vector Insertion
Chr 9: 72758549 - 72759710
Public Clones IST14958C3 (tigm)
Private Clones OST499937 (lexicon) OST14921 (lexicon) OST12391 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055535
Sequence
GTAGTCCCCGGCCGGCCAGGCTGTCCACTGCGCCGCCCTCTACAGCCTCCCTCCGCCCCCGGCTGGACGCGGCGCGCGTGGTCCCCGCGGCCTGGCGCAC

TCGCGGGGCTCCGTGCGCCTGCAAGCGGCGCGTCGCCTTCCCACGCCGGAGCAGCGGGTTGCAGCAGGAGCTGCGGGTCCAGGAGAGCAGCGGGAGCAGC

GGGCGCGGGCGAACAGCCCGGGAGCATGCCCGCGCAGCCCCGCTGAATGGCGCCTCCCGTGCGCCCGGGGATGCTGCCCCTGCTGCTGTTGCTGCTACTG

CCGCCGCTCGGCTCGGTTCCAG - UNI16842 - GAGTGTGGAGCTTTAGCGAACTGTTTTTCATGAAAGAACCACAGGATGCAACAGTCACAAGGAA

AGACCCAGTCGTTTTAGATTGCCAGGCACACGGAGAAGGCCCCATTAAGGTCACATGGTTGAAAAATGGAGCAAAATTGTCCGAAAATAAACGGATCCAG

GTTCTATCTAACGGCTCTCTATACATCAGTGAGGTGGAAGGCAGGAGGGGAGAGCAATCGGATGAAGGATTTTATCAGTGTTTGGCAGTGAACAAATACG

GGGCCATTCTTAGTCAGAAAGCTCATCTGACATTGTCAA - UNI17261 - CTATCTCTGCGTTTGAAGTCCATCCAGTGTCTACTGAGGTCCATGAA

GGAGGAGTTGCTAGATTTTCATGCAAGATTTCATCAACGCCGCCTGCAGTCATAACATGGGAATTTAATAGAACAGCCCTGCCTACAACCATGGACAG G

GTGACTGCCCTGCCATCAGGAGTGTTGCAGATCTACGACGTTGGCCCGGAGGATGCTGGGAATTACCGCTGTGTTGCAGCTACTATAGCTCATAAGAGGA

AAAGCATGGAGGCTTCGCTAACCATAGTTGCAG CTAATGAGACCAGATCCTTCTACATGCCAACCATTATAGCCAGTCCACAGAATGTAACCGCATCTC

TACATCAGACAGTTGTGCTAGAGTGTATGGCCACAGGATATCCCAGACCCATCATTTCCTGGAGCCGTCTTG ATCACAAGTCCATTGATGTCTTCAACA

CTCGGGTACTTGGAAATGGCAACCTCATTATATCAGATGTCAAGCTGCAGCATGCTGGAGTGTATGTTTGTCGGGCCACCACCCCAGGCACACGTAACTT

CACAGTTGCTATGGCAACGTTAACTGTATTAG CTCCTCCTTCATTTGTCGAATGGCCTGAAAGTTTAACAAGGCCACGAGCTGGCACTGCACGATTTGT

GTGCCAAGCAGAAGGAATTCCCTCACCCAAAATGTCCTGGTTGAAAAATGGGAGAAGGATACATTCAAATGGCAGGATTAAAATGTACAACAG CAAATT

GGTCATTAATCAGATTATCCCGGAAGACGATGCTATCTATCAGTGCATGGCTGAAAACAGCCAAGGATCTGTTCTGTCTCGAGCCAGACTGACTGTGGTA

ATGTCGGAAGATAGACCCAGCGCTCCTTACAACGTTCATGCTGAGACCATGTCGAGCTCTGCTATCCTTCTGGCTTGGGAGAGACCACTGTACAATTCAG

ACAAGGTCATCGCCTACTCTGTACACTACATGAAGGCGGAAG GTTTAAATAACGAGGAATATCAGGTGGTCCTTGGAAACGACACGACTCATTACATCA

TTGATGACTTAGAACCCGACAGCAACTATACTTTCTACATTGTGGCGTACATGCCGCTGGGGGCCAGCCAGATGTCGGATCATGTGACACAGAACACGCT

AGAAGATG TGCCCCTAAGACCTCCCGAAATTAGCTTGACGAGTCGAAGTCCCACCGACATTCTCGTCTCCTGGCTGCCAATCCCGGCCAAGTACCGGCG

GGGCCAAGTGGTGCTGTACCGCCTGTCCTTCCGCCTGAGCACTGAGAACGCCATCCAAGTTGTAGAACTCCCGGGGACCGTGCACGAGTACCTTCTGGAA

GGCCTGAAGCCAGACAGTGTCTATCTGGTTCGGATTACTGCAGCTACCCGTGTGGGGCTGGGAGAGTCGTCGGTGTGGACCTCACACAGGACGCCCAAGG

CTACGAGCGTGAAAG CCCCGAAGTCTCCTGAACTGCATTTGGAACCACTGAATTGTACTACCATCTCTGTGAGGTGGCTGCAAGACACAGAGGACCCGG

CCGCTATTCGGGGCTACAAGCTGTTTTATAAAGAGGAAGGGCAGCAAGAACACGGACCTATCTTCCTAGACACCGGTGACCTGCTGTATACGCTCAGTGG

CTTGG - UNI13027 - ACCCCAGAAGAAAATACCACGTGAGGCTCCTGGCTTACAACAACATGGAAGAAGGCTACCAGGCCGACCAGACTGTCAGCA

CTCCCGGATGCGTGT - UNI26599 - CCGTCCGTGATCGCATGGTCCCTCCACCACCGCCACCCCACCATCTCTACGCGAAGGCGAATACCTCCTCT

TCCATCTTCCTGCACTGGAGGAGGCCTGCGTTCACCACCGCCCAAGTCATTAACTACACCATCCGCTGTAACCCTGTTGGCCTGCAGAATGCCTCTCTGG

TTCTCTACCTGCAAAC ATCAGAAACCCACATGCTGGTCCAAGGACTAGAACCAAACACCAAGTATGAATTTGCTGTCCGACTGCATGTGGATCAGCTGT

CCAGTCCCTGGAGTCCTGTGGTCTACCATTCTACATTGCCAGAAG CACCCACAGGCCCCCCGGTAGGGGTAAAGGTGACCCTGATAGAAGACGACACTG

CCCTTGTTTCCTGGAAACCCCCAGATGGCCCAGAGACAGTGGTGACACGCTACACCATCTTGTATGCTTCCAGGAAGGCCTGGATTGCGGGAGAGTGGCA

GGTTCTTCACCGAGAAG GGGCAATCACCATGGCTTTGCTGGAAAACCTGGTGGCAGGGAACGTGTACATTGTCAAGATATCTGCGTCCAACGAGGTGGG

AGAAGGGCCCTTTTCAAACTCCGTGGAGCTGGCCGTCCTCCCCAAGGATGCTTCAGAGTCGAACCAGAGGCCCAAGCGTTTGGATTCTTCCAATGCCAAA

G TTTATTCCGGCTATTACCATCTGGACCAAAAGTCAATGACGGGCATCGCAGTAGGCGTTGGCATAGCCTTGACCTGTATCCTCATCTGTGTTCTCATC

TTGATCTACCGAAGCAAAGCCAG GAAGTCATCCGCCTCTAAGACAGCGCAGAGTGGAACCCAGCCGTTATCCCAAGCCAGTGCCTCTGTAGCAGCAGGG

AGTGACATGGGGAAGAACCTGGAGAGAGCTACAGAGACTGCAGAGTCCTTGGTACCCATGATGCCCAGCAGCTTCATTGACGCGAAG GGAGGGACTGAC

CTGATCATCAATAGCTACGGTCCTATAATTAAAAACAACACTAAGAAAAAGTGGCTTTTTTTCCAAGACACTAAGAAAATCAAAGTTGAACAG - UNI1

5781 - ACTCAAAGAAGATTTACTCAGGCCGTCTGCTTTTACCAGCCGGGCACCACCGTGCTGATCAGCGATGAAGATTCCCCCGGCTCCCCAGGCCAG

ACCGCCAGCTTCCCAAGACCTTTTGGGGCTACTGCCCTTGACACAGAGCATTCAGCGAACAGTGAAGGCAGCCATGAGACAGGGGATTCCGGAAGGTTTT

CCCATGAGTCCAATGATGAGATACACCTGTCCTCCGTCATCAGCAGCACGCCCCCCACCTCGAATCCCCTCGCTGGTGGCGATTCTGATGGGGATGCTGC

ACCGAAGAAGCACGGAGACCCTGCGCAGCCCTTGCCAGCTGAGCAGACCTCAGCTCCGCAGACATCTGCGGGGCTGCGATATGCTGCCGAGGGTTTTCCG

GTCTAGACAGCCACGCTCAGGGATTCACAACAAGCACCTGTTCGAAGGACAATGAGCAGGGAGCCAAAGCCTTTTGTGAAAATCTTGATGTCTTACTGTT

TATTGTTTGTTTTGTTTGTTTGTTTTTTATCTTTTTTTTTAAACTATTTTTAAGCTTACGAATTTTGAATGTTTCAACTGTCAACAATGTGAAAAAGGGC

AGTCAAGATGCTTGACTGGACTCTAAGATAAATCACTGGAGCGGAGGGAAGACTGCCTAAGCCCTCTGCTGAATAGCTACCTCAGTTTGCTGTGGGCAGA

CTCTGAAGACAACTGTGCTGCCTTCTTCGAGTGCTGGTTTCTCTCAGTGGCATAACCAGCGGGACTTGCTAGTGACGCTGTGTGTCCATTGTGTGTGTGC

TGTGTGTGACTGAAGGAGTCCGATAGGTAGGAGAGGAAAGATGTTGATCTGAAGCTCTGATTTTTTTTTTTTTTTTTTAAAGAACCGTGATAATGTAACA

CCTCTGGCTGTGAGGAGAAAATATGGGAGTATATTTATTTGAATGGAAGAAACAAATACGTCTCTTTGGAGAAGAGAACATTCCATAGTACATAGGGGAT

CGTGTCCTTGCAAAGCTGTTGGGTTTGGGACACCAGAGCAGGAGAATTTTGCTCCAGCCTGCATCAGCCTGCCCTCAGCCTGCAAAACCACCTTTCCCTT

TGCTCCACAGCCGGCCAAGGGCTGCGCTGTCTTGTGGAACGTTTTCAAAGTTTACAGAGCTAGCTGCAAAATACAATGTAGGAAAGTGGATTTTTTTTTT

AATGGTTCAGATTTTCTTTTTTAAAATCTCAGTTTGGCTTCAAATGGGGCAAAGAAGAAATGTTATTAAATATTAAGAATGAAGATAAACGAAACAGTAG

AGATTAAGACAGACTTGAGGTTTTCATAATAGCAGTGCCTTCCATTGTGAGAAATTTTGCCTTATACCTTTTTAATATTCACGAAGATGTTTAGGAAAAA

AGGTACCAAAAATTTGCCTTAAAAAAAAAAAAGCTTGGATCTTAGCGATAGCTGTGCTATCTGGCACCTTGATGAAGCTGCTCTCTTTTTGAAGCTCAGG

TTTGCTCCCTATCACCCTGGCGGCTGAACTCTGGCTTCGTAGCCCACTAACACTCCAGAAGCGAGTTCATTCTCTGGTTTAAAATCAACAAATTGTCTCC

TCTTCTGATCCGGCAGCCTTCTCCGTCACAAGGCAACATGCTAGGTGCCGAGCCACGTGGGAAGGACAAAGACTGAGCTGTGAAAAGAAGAAACAAGTCC

TTAGCCTTTTAAAATCATGAGTTTTGCCCTCCCTGAAATTTTTTTGGAAGTGGCTTTGAATTGCATTTTAAAAGAAAAGCCCTCCGTGGGTTTTCCCTTG

AAACCGTCCCTCCATGCACAGACAAGGCAGGTCCTGCCAAATGGTGTTATCACCCCAGTGTCATCTATTGCGAAAGCCTGACACTGCCACAGTTTTCATC

GTCATTCTAAGTTTTGTGCCAAATTGGACTTTCTTAGAAGCCCAGGCACTACTCAGCACAGTTCTGTCCCATTCACCATGGGCTTCTCGGCAAAATGGGG

GGAAAAAAGAAAGAAGAAAGAAAAAAAAAAAAAGCAGAGCTTTAGGTAAACAGTCGGAGGGGAGAAAAAATGGCTTCCTTCCCCTGCCTTCGCGCTCCTG

TTTATACTACCTCCTTTTTAAAGTTATTCTAGTGTTATTGTTCTTTCCTGTACTCAGGGACTTTTTTGTTACTCTTGAGCTCATGTTGCATGGGCGGGTG

CATTGACAGGGTATGGTGGTGTTTGGTTCGTAAGTAGAAGTACGTGGGCCAACTTCTCTCAG
Translation
MAPPVRPGMLPLLLLLLLPPLGSVPG - UNI16842 - GVWSFSELFFMKEPQDATVTRKDPVVLDCQAHGEGPIKVTWLKNGAKLSENKRIQVLSNG

SLYISEVEGRRGEQSDEGFYQCLAVNKYGAILSQKAHLTLST - UNI17261 - TISAFEVHPVSTEVHEGGVARFSCKISSTPPAVITWEFNRTALP

TTMDR RVTALPSGVLQIYDVGPEDAGNYRCVAATIAHKRKSMEASLTIVAA ANETRSFYMPTIIASPQNVTASLHQTVVLECMATGYPRPIISWSRLD

 DHKSIDVFNTRVLGNGNLIISDVKLQHAGVYVCRATTPGTRNFTVAMATLTVLA APPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSWLKNGRRIH

SNGRIKMYNS SKLVINQIIPEDDAIYQCMAENSQGSVLSRARLTVVMSEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEG GLNN

EEYQVVLGNDTTHYIIDDLEPDSNYTFYIVAYMPLGASQMSDHVTQNTLEDV VPLRPPEISLTSRSPTDILVSWLPIPAKYRRGQVVLYRLSFRLSTEN

AIQVVELPGTVHEYLLEGLKPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKA APKSPELHLEPLNCTTISVRWLQDTEDPAAIRGYKLFYKEEGQ

QEHGPIFLDTGDLLYTLSGLD - UNI13027 - DPRRKYHVRLLAYNNMEEGYQADQTVSTPGCVS - UNI26599 - SVRDRMVPPPPPPHHLYA

KANTSSSIFLHWRRPAFTTAQVINYTIRCNPVGLQNASLVLYLQT TSETHMLVQGLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEA APTGPPVGV

KVTLIEDDTALVSWKPPDGPETVVTRYTILYASRKAWIAGEWQVLHREG GAITMALLENLVAGNVYIVKISASNEVGEGPFSNSVELAVLPKDASESNQ

RPKRLDSSNAKV VYSGYYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKAR RKSSASKTAQSGTQPLSQASASVAAGSDMGKNLERATETAESLVP

MMPSSFIDAK GGTDLIINSYGPIIKNNTKKKWLFFQDTKKIKVEQ - UNI15781 - TQRRFTQAVCFYQPGTTVLISDEDSPGSPGQTASFPRPFG

ATALDTEHSANSEGSHETGDSGRFSHESNDEIHLSSVISSTPPTSNPLAGGDSDGDAAPKKHGDPAQPLPAEQTSAPQTSAGLRYAAEGFPV

For any suggestions or comments, please send an email to unitrap@crg.es