Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036057 (Ptpn23)
Chromosomal location
Chr 9: 110287593 - 110310714 (-)
Description
protein tyrosine phosphatase, non-receptor type 23 Gene [Source:MGI Symbol;Acc:MGI:2144837]
RefSeq_dna
NM_001081043 
RefSeq_peptide
NP_001074512.1 
UniGene
Mm.335477 
MGI
MGI:2144837 
Uniprot/SWISSPROT
Q6PB44 
Human Ortholog
ENSG00000076201 (PTPN23)
Omim not available
UniTrap UNI2754
Vector Insertion
Chr 9: 110300700 - 110310537
Public Clones AK0174 (sanger) D175C12 (ggtc) (ggtc) D071F06 (ggtc) IST14113E9 (tigm)
Private Clones OST458838 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6566
Vector Insertion
Chr 9: 110291900 - 110291976
Public Clones YHB130 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040021
Sequence
TTCCGGCGTGGAGGGGCGGGGTTGCGCGCGCGGCTGAAGCAGCTGCTGGACCTGGGAGGGGAGCGGCCCTAGGGCCGCTAGGCGCTACCCGCGATGGAGG

CCGTGCCCCGGATGCCCATGATCTGGCTGGACCTGAAGGAGGCCGGTGACTTTCACTTCCAGTCTGCGGTGAAGAAG - UNI2754 - TTTGTCCTGA

AGAATTATGGAGAGAACCCAGAAGCCTACAACGAGGAACTAAAGAAGCTGGAATTACTCAGACAG AATGCTATTCGCGTTGCCCGGGACTTTGAGGGCT

GCAGTGTTCTTCGAAAGTACCTTGGCCAGCTACACTACCTACAGAGTCGGGTGCCCATGGGCTCAGGCCAGGAGGCTGCTGTAGCTGTCACCTG GACTG

AGATCTTCTCGGGCAAGTCTGTGTCCCATGAAGACATCAAGTACGAGCAGGCCTGTATTCTCTACAACCTCG GTGCACTGCACTCCATGCTGGGGGCTA

TGGACAAGCGGGTGTCTGAGGAG GGCATGAAAGTCTCCTGCACCCACTTCCAGTGTGCAGCAGGCGCCTTTGCCTACCTGCGTGAACACTTCCCACAGG

CCTTCAGTGTGGACATGAGTCGCCAGATCCTTACGCTCAATGTCAACCTCATGCTG GGCCAGGCTCAGGAGTGCCTGTTGGAGAAGTCCATGTTGGACA

ACCGGAAGAGCTTTCTAGTGGCCCGCATCAGCGCACAG GTGGTAGATTACTATAAGGAGGCATGCCGGGCCTTGGAAAACCCTGATACTGCCTCCCTGC

TGGGCCGTATCCAGAAAGACTGGAAGAAACTTGTCCAAATGAAGATCTACTACTTTGCGGCTGTGGCTCAT CTACACATGGGGAAGCAGGCTGAGGAGC

AACAGAAATTTGGGGAACGG GTGGCCTACTTCCAGAGTGCCCTGGACAAGCTTAATGAAGCCATCAAGTTGGCCAAG GGCCAGCCCGACACTGTGCAA

GATGCACTTCGCTTTGCTATGGATGTCATCGGGGGCAA ATATAATTCTGCCAAGAAGGACAATGACTTTATCTACCATGAGGCTGTGCCAGCACTGGAT

ACACTCCAGCCTGTGAAAG GAGCTCCCTTGGTGAAGCCCTTGCCAGTAAACCCCACAGACCCAGCTGTTACAGGTCCTGACATCTTTGCCAAGTTGGTG

CCCATGGCTGCCCATGAGGCCTCATCACTGTACAG TGAGGAGAAGGCCAAACTGCTTCGGGAGATGCTGGCCAAAATTGAAGATAAGAATGAGGTCCTA

GA TCAGTTCATGGACTCCATGCAGCTGGACCCTGAGACAGTGGACAACTTGGATGCCTACAACCATATCCCCCCCCAGCTCATGGAGAAGTGTGCGGCA

CTCAGCGTCCGGCCTGACACTGTCAAGAACCTTGTCCAGTCTATGCAGG TGCTGTCAGGGGTGTTCACGGATGTGGAGGCCTCCCTGAAGGACATCAGG

GATCTACTGGAGGAAGATGAGCTGCAAGAGCAGAAATTGCAGGAGACCCTGGGCCAGGCCGGGGCTGGCCCTGGCCCCTCTGTTGCCAAGGCTGAGCTTG

CAGAGGTGAGGCGAGAATGGGCCAAGTACATGGAAGTGCATGAAAAGGCTTCCTTCACCAACAGTGAGCTGCATCGTGCTATGAACCTGCATGTTGGTAA

CTTGCGCCTGCTCAGTGGACCACTGGACCAGGTGCGGGCTGCCCTACCCACACCAGCCCTCACCCCAG - UNI6566 - AGGACAAAGCCGTGCTGCA

AAACCTAAAGCGCATCCTCGCCAAGGTGCAGGAGATGCGGGACCAGCGTGTGTCCTTGGAACAGCAGCTCCGAGAGCTGATCCAGAAGGATGACATCACT

GCCTCTCTGGTCACCACTGACCACTCAGAGATGAAG AAACTGTTTGAGGAGCAGCTGAAGAAGTATGACCAGCTGAAGGTCTACCTGGAGCAGAACCTG

GCCGCCCAGGACAATGTCCTCCGTGCCCTGACTGAGGCCAACGTGCAGTATGCAGCCGTGCGGCGGGTGCTTAGTGAGCTGGACCAAAA GTGGAACTCC

ACACTACAGACCCTGGTAGCATCCTATGAGGCCTATGAGGACCTGATGAAGAAGTCCCAAGAAGGCAAGGACTTTTATGCAGACTTGGAAAGCAAGGTAG

CTACCCTTCTGGAACGGGCACAATCCATCTGTCGTGCCCAAGAGGCCGCTCGCCAGCAGCTCCTGGACAG AGAGCTGAAGAAGAAGGCACCACCACCTC

GGCCTACAGCCCCAAAGCCATTGCTGTCCCGCCGTGAGGAGGGGGAGGCAGTGGAGGCTGGAGACACACCTGAGGAGCTGCGCAGCTTGCCCCCTGACAT

GATGGTTGGCCCACGGCTACCTGACCCATTCCTAGGAACTACTGCCCCTCTCCACTTTTCTCCTGGCCCCTTCCCTAGTTCCACAGGCCCAGCAACCCAC

TATCTCTCAGGACCCTTACCCCCTGGAACTTATTCAGGCCCCACTCAACTGATGCAGCCTAGGGCTGCAGTTCCCATGGCACCTGCAACGGTCCTCTACC

CAGCCCCTGCCTATACATCGGAGTTGGGCCTCGTACCCAGATCCTCTCCCCAGCATGGAATTGTAAGCAGTCCCTATGCAGGGGTAGGGCCACCCCAACC

AGTTGTAGGTCTTCCCTCTGCTCCACCTCCCCAGCTCTCAGGACCCGAGTTAGCCATGACAGTTCGGCCAGCTACCACCACAGTAGATAGTGTCCAAGCC

CCTATCTCTAGCCACACGGCACCACGGCCAAACCCTACCCCTGCTCTTCCCCAGCCCTGCTTTCCAGTGCCTCAGCCTGTACCTCAATCTGTTCCCCAAC

CACAGCCTCTGCCTGTACCCTATACTTATTCTATAGGGACCAAGCAGCCTCTGCCTGCACCCTATACTTACTCTATAGGGACCAAGCAGCACCTCACTGG

CCCTCTACCACAGCATCAGTTTCCTCCTGGGATCCCCACAGGCTTTCCAGTCCCCAGGACTGGGCCCCAGGCCCAGGCCCAGCCCCAACCCCAGCCCCAG

CCCCAGCCTCAGCCTCAGCCCCAGCCCCAGCCCCAGCCCCAGCCCCAGTCCCAGTCCCAGCCCCAGCCCCAGCCCCAGCCTCAGCCCCAACGGCCAGCAT

TTGGGCCACAACCCACACAACAGCCCCTTCCATTCCAGCATCCACATCTCTTCCCATCTCAGGCCCCAGGGATTCTTCCACCACCACCACCAACACCCTA

CCATTTTACTCCTCAGCCTGGTGTCTTGGGACAACCACCACCCACCCTACACACCCAGCTCTATCCAGGCCCATCTCAAGACCCTCTTCCCCCACATTCA

GGGGCTCTGCCTTTCCCCAGCCCTGGGCCCCCTCATCCTCACCCCACCCTGGCATATGGCCCTGCCCCTTCCCCTAGGCCCCTTGGTCCTCAGGCAACCC

CTGTCTCCATTCGAGGCCCCCCACCAGCCAGTCAGCCCACCCCTAGTCCACACTTGGTGCCTTCACCTGCCCCATCACCAGGGCCTGGCCCAGTACCTTC

AAGACCTCCAACAGCCGAGCCACCACCTTGTTTGCGCCGAGGTGCTGCAGCTGCAGACCTTCTGTCTTCTAGCCCTGAGAGCCAGCATGGAGGTACCCAG

CCTCCTGGGGGTGGGCAGCCCTTGCTACAGCCTACCAAGGTAGATGCAGCTGAGGGCCGTCGGCCACAGGCCCTGCGGCTAATTGAGCAGGACCCCTATG

AACATCCCGAGAGGCTGCAGCAGTTGCAGCAGGAGCTGGAGGCCTTTCGGGGCCAGCTGGGGGATGCAGGAGCACTGGATGCCATCTGGAGAGAGTTGCA

AGAGGCACAGGAACACGATGCCCGAGGTCGATCCATTGCCATTGCCCGCTGCTACTCCCTGAAGAACCGGCACCAGGATGTCATGCCGTATGACAGCAAC

CGTGTGGTGCTGCGCTCAGGCAAAGATGATTATATTAATGCTAGCTGTGTGGAGGGGCTCTCGCCATACTGTCCACCCTTAGTGGCCACCCAGGCTCCGC

TGCCTGGCACAGCTGCAGATTTCTGGCTCATGGTGCATGAACAGAAAGTGTCAGTCATTGTCATGCTGGTGTCTGAGGCTGAGATGGAAAAG CAAAAGG

TGGCGCGTTACTTCCCCACAGAGAGGGGCCAGCCCATGGTGCATGGAGCCCTGAGCGTGGCACTGAGCAGTATTCGTACTACTGAGACCCATGTGGAGCG

AGTGCTGAGTCTGCAGTTCCGGGATCAGAGCCTCAAGCGCTCTCTTGTGCACCTCCATTTCCCTACTTGGCCTGAGTT AGGCCTGCCAGACAGCCCTGG

CAATCTGCTGCGCTTCATCCAGGAGGTGCATGCACATTATTTGCACCAGCGACCCCTGCACACACCTATTGTCGTACACTGCAG CTCTGGGGTGGGCCG

CACAGGAGCCTTCGCGTTGCTCTATGCAGCCGTGCAGGAGGTGGAGGCTGGGAATGGGATTCCAGAGCTGCCCCAGCTGGTGAGGCGGATGCGGCAGCAG

AGGAAACACATGCTGCAGGAAAAA CTTCACCTCAAGTTCTGCCATGAGGCGTTGGTGAGACATGTGGAGCAGGTCCTACAGCGCCATGGTGTGCCTCCT

CCTGGCAAGCCTGTGGCCAGTGTGAACATCAGCCAGAAG AACCACCTTCCTCAGGACTCCCAGGATCTGGTCCTTGGTGGAGACGTGCCCATCAGCTCC

ATTCAGGCTACCATTGCCAAGCTCAGCATCCGGCCCCTAGGTGGCTTGGATTCCCCAGCTGCCAGCCTCCCAGGCCTTGTAGAACCCCCAGGTCTTCCAC

CAGCTAGCCTTCCAGAGTCTACCCCTGTCCCATCTTCCTCGCCTCCCCCACTCTCTTCACCTCTGCCTGAAGCCCCCCAGCCAGAGGAGGAGCCGTCAGT

GCCTGAAGCCCCCAGCTTAGGGCCCCCCTCGTCATCCCTGGAGCTGTTGGCCTCTCTGACTCCAGAAGCATTTTCACTGGACAGTTCTTTACGGGGAAAG

CAGCGGATGAGCAAGCAGAACTTTCTGCAGGCCCACAACGGGCAGGGTCTAAGGGCTGCCCAGCCTACGGATGACCCCCTCAGCCTCCTGGATCCACTCT

GGACACTCAACAAGACCTGAAAAGGCTTTGCCTATCTGATCCTTACACTACACCTCCCATCCCTGCTGCCTTCAGCTCTGCCAGATGGAGATGCACTGCA

GGCCTCAGATCAGGCTCTGCTCCCTTGAGGAACCTGACATTTTTCCAGCCCTGGGCTGCTGAAATAATAAACTTATTCTGTGGC
Translation
MEAVPRMPMIWLDLKEAGDFHFQSAVKK - UNI2754 - FVLKNYGENPEAYNEELKKLELLRQ NAIRVARDFEGCSVLRKYLGQLHYLQSRVPMGS

GQEAAVAVTW WTEIFSGKSVSHEDIKYEQACILYNLG GALHSMLGAMDKRVSEE GMKVSCTHFQCAAGAFAYLREHFPQAFSVDMSRQILTLNVNLM

L GQAQECLLEKSMLDNRKSFLVARISAQ VVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAH LHMGKQAEEQQKFGER VAYFQSAL

DKLNEAIKLAK GQPDTVQDALRFAMDVIGGK KYNSAKKDNDFIYHEAVPALDTLQPVKG GAPLVKPLPVNPTDPAVTGPDIFAKLVPMAAHEASSLY

S SEEKAKLLREMLAKIEDKNEVLD DQFMDSMQLDPETVDNLDAYNHIPPQLMEKCAALSVRPDTVKNLVQSMQV VLSGVFTDVEASLKDIRDLLEED

ELQEQKLQETLGQAGAGPGPSVAKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALPTPALTPE - UNI6566 - EDK

AVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMK KLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQ

K KWNSTLQTLVASYEAYEDLMKKSQEGKDFYADLESKVATLLERAQSICRAQEAARQQLLDR RELKKKAPPPRPTAPKPLLSRREEGEAVEAGDTPEE

LRSLPPDMMVGPRLPDPFLGTTAPLHFSPGPFPSSTGPATHYLSGPLPPGTYSGPTQLMQPRAAVPMAPATVLYPAPAYTSELGLVPRSSPQHGIVSSPY

AGVGPPQPVVGLPSAPPPQLSGPELAMTVRPATTTVDSVQAPISSHTAPRPNPTPALPQPCFPVPQPVPQSVPQPQPLPVPYTYSIGTKQPLPAPYTYSI

GTKQHLTGPLPQHQFPPGIPTGFPVPRTGPQAQAQPQPQPQPQPQPQPQPQPQPQPQSQSQPQPQPQPQPQRPAFGPQPTQQPLPFQHPHLFPSQAPGIL

PPPPPTPYHFTPQPGVLGQPPPTLHTQLYPGPSQDPLPPHSGALPFPSPGPPHPHPTLAYGPAPSPRPLGPQATPVSIRGPPPASQPTPSPHLVPSPAPS

PGPGPVPSRPPTAEPPPCLRRGAAAADLLSSSPESQHGGTQPPGGGQPLLQPTKVDAAEGRRPQALRLIEQDPYEHPERLQQLQQELEAFRGQLGDAGAL

DAIWRELQEAQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSE

AEMEK QKVARYFPTERGQPMVHGALSVALSSIRTTETHVERVLSLQFRDQSLKRSLVHLHFPTWPEL LGLPDSPGNLLRFIQEVHAHYLHQRPLHTPI

VVHCS SSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEK LHLKFCHEALVRHVEQVLQRHGVPPPGKPVASVNISQK NHLPQDS

QDLVLGGDVPISSIQATIAKLSIRPLGGLDSPAASLPGLVEPPGLPPASLPESTPVPSSSPPPLSSPLPEAPQPEEEPSVPEAPSLGPPSSSLELLASLT

PEAFSLDSSLRGKQRMSKQNFLQAHNGQGLRAAQPTDDPLSLLDPLWTLNKT

For any suggestions or comments, please send an email to unitrap@crg.es