Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036098 (Gm98)
Chromosomal location
Chr 19: 10283795 - 10315238 (-)
Description
gene model 98, (NCBI) Gene [Source:MGI Symbol;Acc:MGI:2684944]
MGI
MGI:2684944 
Uniprot/SWISSPROT
Q3UR85 
Uniprot/SPTREMBL
B2RXQ7 
Human Ortholog
ENSG00000124920 (C11orf9)
Omim not available
UniTrap UNI15384
Vector Insertion
Chr 19: 10303509 - 10315239
Public Clones (sanger) D051A05 (ggtc) PST7391-NL (escells) IST10251A10 (tigm) IST14820D6 (tigm)
IST13648D9 (tigm) IST14420F2 (tigm) IST11112G9 (tigm) IST14971E9 (tigm)
IST10921F11BBF1 (tigm) IST13157D6 (tigm) IST10118A10 (tigm) IST15053G7 (tigm)
IST14507C2 (tigm) IST11034D7 (tigm) IST15051C11 (tigm) IST13293B10 (tigm)
IST15009G7 (tigm) IST10356A8 (tigm)
Private Clones OST192893 (lexicon) OST191259 (lexicon) OST183922 (lexicon) OST124809 (lexicon)
OST52593 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22237
Vector Insertion
Chr 19: 10303407 - 10303509
Public Clones not available
Private Clones OST302737 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17693
Vector Insertion
Chr 19: 10299938 - 10300001
Public Clones not available
Private Clones OST438075 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30044
Vector Insertion
Chr 19: 10299938 - 10303407
Public Clones D139H01 (ggtc) D139G01 (ggtc) IST12567A6 (tigm) IST12401G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25846
Vector Insertion
Chr 19: 10298058 - 10298861
Public Clones not available
Private Clones OST158287 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32388
Vector Insertion
Chr 19: 10295667 - 10297731
Public Clones IST12354D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088013
Sequence
GGGGAGCGAGCGTGAGGAGAGCCTGGCCGGACTGTACCGGGAGCCCAGCCGGGACTGTCGCGCGGGCCGCGCCGGCGATGCCGCGCCCCCGGGCCAGGCT

GTAGCGGGGCTGCGGCCGGAGCGCACGCGGCGGGCAGGCGGGCCATGGAGGTGGTGGACGAGACCGAAGCGCTGCAGCGCTTCTTCGAAG - UNI1538

4 - GCCATGACATCAGCGGTGCCCTGGAGCCCTCCAATATAGACACCAGTATCCTGGAGGAGTACATTGGCAAAGAGGACGCCTCTGATCT - UNI15

384 - - UNI22237 - - UNI30044 - CTGCTTCCCTGAGATCTCTGCACCAGCCAGCACTGCCTCCTTCCCCCACGGGCCACCGGCCATTCCCG

GCTCCAGCGGGCTCCACCATCTGAGCCCCCCTGGGAGCGGACCATCCCCTGGGCGCCATGGCCCCCTCCCACCCCCGACCTACGGCACCCCACTCAACTG

CAACAACAACAACGGCATGGGCACCGCCCCTAAGCCCTTCCTGGGGGGCTCTGGGCCTCCCATCAAAGCAGAGCCAAAGGCCCCCTATGCCCCAGG - U

NI17693 - - UNI30044 - CACACTGCCAGACTCGCCCCCAGACTCAGGCTCTGAGGCCTACTCCCCTCAGCAGGTGAATG - UNI17693 - -

 UNI30044 - ACCCCCATCTTCTACGCACCATAACCCCGGAGACTCTATGCCACGTGGGAGTTTCTTCCCGCCTGGAGCACCCGCCCCCACCTCCAGC

CCACCTGCCAGGCCCACCACCACCGCCACCTCCCCCACCTCACTACCCTGTCCTGCAACGGGACCTCTACATGAAGGCTGAGCCCCCTGTACCCCCTTAT

GCTGCCATGGGGCCGGGTCTGGTGCCCCCCGAGCTCCATCACACCCAGCAGACCCAGGTGCTACACCAGCTGCTGCAACAGCATGGAGCTGA - UNI25

846 - ACTCCCTCCACACCCCTCTAAGAAGAGGAAGCACTCTGAATCACCCCCCAACACCCTCAATGCCCAAATGCTGAACGGAATGATCAAGCAGGAA

CCTGGGACTGTCACAGCCTTGCCTCCACACCCTGCCAGAGCCCCATCCCCTCCATGGCCTCCTCAAGGCCCACTGTCACCTGGCACTGGATCCTTGCCCC

TCAGCATTGCCCGAGCCCAGACTCCACCCTGGCACCCGCCAGGTGCACCCTCCCCAG - UNI32388 - GCCTCCTGCAGGACAGTGACAGCCTCAGT

GGCTCCTATTTGGACCCCAACTACCAATCCATCAAATGGCAGCCGCATCAGCAGAACAAGTGGGCGACCCTGTATGACGCTAACTACAAGGAGCT - UN

I32388 - GCCTATGCTCACCTATCGTGTGGACGCTGACAAGGGCTTCAACTTTTCCGTGGGCGACGATGCTTTTGTGTGCCAGAAGAAGAACCACTTC

CAGGTGACCGTGTACATCGGCATGCTGGGGGAGCCCAAGTACGTCAAGACACCGGAAGGCCTCAAGCCCCTGGACTGCTTCTATCTGAAGCTGCATGGTG

TGAAG - UNI32388 - CTAGAGGCCCTGAACCAGTCTATCAACATTGAGCAGTCACAGTCAGACAGAAGCAAGAGGCCCTTCAACCCCGTCAC GGT

CAATCTTCCCCCTGAGCAGGTCACAAAAGTGACCGTGGGGCGGCTCCATTTCAGTGAGACCACTGCCAACAACATGCGCAAGAAGGGCAAGCCCAACCCT

GACCAGAG GTATTTCATGCTGGTGGTGGCCCTCCAGGCACATGCACAGAACCAGAACTACACACTGGCAGCCCAGATCTCAGAGCGTATCATTGTGCGG

 GCCTCTAACCCAGGCCAGTTTGAAAGTGACAGTGACGTGCTGTGGCAACGGGCGCAGCTGCCAGATACGGTCTTCCACCATGGCCGTGTGGGCATCAAC

ACCGACCGGCCAGATGAGGCATTGGTCGTCCACGGCAACGTGAAGGTCATGGGTTCTCTTATGCACCCTTCCGATCTGCGGGCCAAGGAGCACGTGCAGG

AG GTGGACACCACCGAGCAGCTGAAGAGGATCTCTCGGATGCGGCTGGTGCACTACAGATACAAGCCTGAGTTCGCTGCTAGCGCAGGCATTGAAGCCA

CCGCACCGGAGACAG GTGTCATCGCCCAGGAAGTGAAGGAGATCCTGCCTGAAGCTGTGAAGGACACAGGGGATGTAGTCTTTGCCAATGGGAAAACCA

TAGAGAACTTCCTTGTAGTGAACAAG GAGCGAATCTTCATGGAGAATGTGGGGGCTGTGAAGGAGTTATGCAAACTGACAGACAACCTAGAGACTCGCA

TTGATGAGTTGGAGCGATGGAGCCACAAGCTGGCCAAGCTGCGGCGCCTTGACAGCCTCAAGTCAACTGGCAGCTCAGGGGCTTTCAG CCATGCAGGGA

GCCAGTTTAGCCGGGCAGGCAGTGTCCCCCACAAAAAGAGGCCCCCTAAACTGGCCAATAAG TCATCGCCAGCGGTCCCAGACCAGGCCTGCATCAGTC

AGCGTTTTCTGCAGGGAACTATCATAGCTCTGGTGGTGGTCATGGCCTTCAGGTGACTTGTCCTCTCAGGTTCTGGGGAGGCTGCTTTAGAAAAGAGAGC

TACCCAGTGAGTCAGATGTGCCTGGGGTCCAGGCTCTGGAGTTGGGGGAGGAAAATGGGCTGGGGATCAAGCAGCCGAGAAAAGTGGGCTGCCTAGTCTG

TCTCCCCCTCCAGGGTCTGGGAAGGCCACAGAGCCTGCTGTAGAGAAACAGTGTTGGGTGGTGGCTTGCATTCAGACAGTGACACTTTTCTGTGGCTCCC

AGCGTGGTGTCTATGTCCACACTATATGTGCTGAGCCTGCGCTCTGAAGAGGACCTGGTGGATGCTGATGG CAGGTCCAGCCAGAGCTTCGGGACCACA

CAGCTCCGACAGTCCTCCATGACCACCGGACTACCAGGCACACAGCCCTCTTTGCTGCTGG TTACCAAGTCAGCCTCGGGTCCAGCTCTCCGTGCCTTG

GACCTGTGCTCCAGCCAGCCCTGCCCCATCGTCTGCTGCTCTCCTCCCGTCTCCAGTCCTGCTACAGATCCTGCCCTTGGCCCCACTCTTACTCCTACTC

CAAGCCCCAGCTCTAACCCCAAGCACTCAG GCCCTGGCCAGATGGCCCCACTGCCAGTCACCAACATCAGAGCCAAATCCTGGGGCATCTCAGCTAATG

GCATCAGCTATTCCAAGCATTCCAAGAGCCTGGAACCTCTGGCCAGTCCTGTGGTCCCCTTTCCTGGAGGGCAGAGCAAGACCAAGAACAGCCCCAGCTT

CAATCTCCAAAGTCGAGCCCGCAGAGGAGCCCCGCAACCCAGCCCAAGCCCTGCCCAATTCACACAGACCCAGGGCCAGCTAG ACCCAGCGCCATCCCT

GACCTCCATCCAGCTGCTGGAGAATTCCATGCCTATCACTTCTCAGTACTGTGTGCCAGAAGGTGCTTGCAG GCTTGGCAACTTCACCTACCACATCCC

TGTCAGCAGCAGCACACCACTGCACCTCAGCCTGACCCTGCAGATGAA TTCCTCCACCCCTGTGTCCGTGGTACTGTGCAGCCTGACATCGGAGGAGGA

GCCCTGTGAGGAGGGAGGCTTTTTGCAGAGGTTCCACCCGCATCAGGACACCCAG GGCACCTCTCATCAGTGGCCAGTAACCATCCTGTCCTTCCGTGA

ATTCACATACCACTTCCGGGTGACATTGCTG GGTCAGGCCAACTGCAGCTCAGAGGCCATCGTTCAGCCAGCCACCGACTACTACTTCCACTTCTACCG

CCTGTGTGACTGAGCTGCCTCCTGAGGCAGTGCCACAGCCGGGACTGGAGTCCCTGGGCCCTCAACACTGGATGCAAATGTGTTACACTGGAGCCTGCTG

CAGGCCAGCTCTCTGCTCTTCACTGCTTCCCTTGACTGGGGAGACTGGAAGTCCTTACACTGGAGTTGCTGGGCCAACTGGTCACCCTCACACAGCACAG

AGGGGGCTAGAGGGAACAGCCTCCTGGGTCTTCCTTCTGGTCATCTCCTTGGGGCAGCACAGGACCACTTCATGGCTGTCTAGTTATGGTCCCTGGAGGG

CTATTTGCCCACCTTCACTCTCCCTGCCTTCCCTTCTGAGTTGTGGTAGAGCAAAGACCCACAGGGGTTGGACCCAGACCTCTTAAAACCTGGCTGGACC

CCCATGAGTCCACGCAGAGTCAATAACTCACCTGTCATGCTGTTCCCAGGAGGGACAGCTTGGTAGGAACTTTCTGGGGTTTGACTGTTACACTAGACAT

GGATTTCTAAGCTTTAAGTGTGGTTGGTTTAGGAGAGTTTTCCTTGGGAGAGCTAGCCCTGAGGTAGTCAGGGCTAGCTCCGGATGGCTGGAGAAGCTGA

CCTTGTGCCTTAAGTCTACTAGTGCCTGATGGAGCCACCCTCATAGGGCTGAACCAGTGGGGCTGACGGGCCAGGTCAGCCTTGGACCCTTGATCCTGGA

GGACCCTGGAAGGGGTGGTTCCCTGTAAGCTCCCAAGATCTATGTTCCTGGGAGTTTCCCAAACTCATGATGGAGTTGGTGACAAGAGCAGAGGAGCAAG

AATCCCTGCAAGCAGTAGACTGGTTTCCACTGGAGGGTGAATGCAGATACCTTTTATTAACGATATACTTACTAAATGCACTTAAACCAGGTACCAAGGA

GTAGGACAGAACTGGAAAGCTGAGTGGGCCTCAGTGTGGAGAGGTACTAGTGGACAGGACTTTCATGGCTTGGGTCCATGCTCCTCCCACACCCAAGAGG

AGTGGTGGGTTTGAGTTTGGAGGTTTTACTCAAGTGACAGCTTCAGCATTTCTTGGTAGCACCTACAGCATTCTGATTACATGCAGGTTCCTG
Translation
MEVVDETEALQRFFEG - UNI15384 - GHDISGALEPSNIDTSILEEYIGKEDASDL - UNI15384 - - UNI22237 - - UNI30044 - 

LCFPEISAPASTASFPHGPPAIPGSSGLHHLSPPGSGPSPGRHGPLPPPTYGTPLNCNNNNGMGTAPKPFLGGSGPPIKAEPKAPYAPG - UNI17693

 - - UNI30044 - GTLPDSPPDSGSEAYSPQQVND - UNI17693 - - UNI30044 - DPHLLRTITPETLCHVGVSSRLEHPPPPPAHLPGP

PPPPPPPPHYPVLQRDLYMKAEPPVPPYAAMGPGLVPPELHHTQQTQVLHQLLQQHGAE - UNI25846 - ELPPHPSKKRKHSESPPNTLNAQMLNG

MIKQEPGTVTALPPHPARAPSPPWPPQGPLSPGTGSLPLSIARAQTPPWHPPGAPSPG - UNI32388 - GLLQDSDSLSGSYLDPNYQSIKWQPHQQ

NKWATLYDANYKEL - UNI32388 - LPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHGVK - UNI

32388 - LEALNQSINIEQSQSDRSKRPFNPVT TVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQR RYFMLVVALQAHAQNQNYTLAAQISE

RIIVR ASNPGQFESDSDVLWQRAQLPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQE VDTTEQLKRISRMRLVHYRYKPEFAA

SAGIEATAPETG GVIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNK ERIFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGS

SGAFS SHAGSQFSRAGSVPHKKRPPKLANK SSPAVPDQACISQRFLQGTIIALVVVMAFR        
Transcript ENSMUST00000096230
Sequence
GGGGAGCGAGCGTGAGGAGAGCCTGGCCGGACTGTACCGGGAGCCCAGCCGGGACTGTCGCGCGGGCCGCGCCGGCGATGCCGCGCCCCCGGGCCAGGCT

GTAGCGGGGCTGCGGCCGGAGCGCACGCGGCGGGCAGGCGGGCCATGGAGGTGGTGGACGAGACCGAAGCGCTGCAGCGCTTCTTCGAAG - UNI1538

4 - GCCATGACATCAGCGGTGCCCTGGAGCCCTCCAATATAGACACCAGTATCCTGGAGGAGTACATTGGCAAAGAGGACGCCTCTGATCT - UNI15

384 - - UNI22237 - - UNI30044 - CTGCTTCCCTGAGATCTCTGCACCAGCCAGCACTGCCTCCTTCCCCCACGGGCCACCGGCCATTCCCG

GCTCCAGCGGGCTCCACCATCTGAGCCCCCCTGGGAGCGGACCATCCCCTGGGCGCCATGGCCCCCTCCCACCCCCGACCTACGGCACCCCACTCAACTG

CAACAACAACAACGGCATGGGCACCGCCCCTAAGCCCTTCCTGGGGGGCTCTGGGCCTCCCATCAAAGCAGAGCCAAAGGCCCCCTATGCCCCAGG - U

NI17693 - - UNI30044 - CACACTGCCAGACTCGCCCCCAGACTCAGGCTCTGAGGCCTACTCCCCTCAGCAGGTGAATG - UNI17693 - -

 UNI30044 - ACCCCCATCTTCTACGCACCATAACCCCGGAGACTCTATGCCACGTGGGAGTTTCTTCCCGCCTGGAGCACCCGCCCCCACCTCCAGC

CCACCTGCCAGGCCCACCACCACCGCCACCTCCCCCACCTCACTACCCTGTCCTGCAACGGGACCTCTACATGAAGGCTGAGCCCCCTGTACCCCCTTAT

GCTGCCATGGGGCCGGGTCTGGTGCCCCCCGAGCTCCATCACACCCAGCAGACCCAGGTGCTACACCAGCTGCTGCAACAGCATGGAGCTGA - UNI25

846 - ACTCCCTCCACACCCCTCTAAGAAGAGGAAGCACTCTGAATCACCCCCCAACACCCTCAATGCCCAAATGCTGAACGGAATGATCAAGCAGGAA

CCTGGGACTGTCACAGCCTTGCCTCCACACCCTGCCAGAGCCCCATCCCCTCCATGGCCTCCTCAAGGCCCACTGTCACCTGGCACTGGATCCTTGCCCC

TCAGCATTGCCCGAGCCCAGACTCCACCCTGGCACCCGCCAGGTGCACCCTCCCCAG - UNI32388 - GCCTCCTGCAGGACAGTGACAGCCTCAGT

GGCTCCTATTTGGACCCCAACTACCAATCCATCAAATGGCAGCCGCATCAGCAGAACAAGTGGGCGACCCTGTATGACGCTAACTACAAGGAGCT - UN

I32388 - GCCTATGCTCACCTATCGTGTGGACGCTGACAAGGGCTTCAACTTTTCCGTGGGCGACGATGCTTTTGTGTGCCAGAAGAAGAACCACTTC

CAGGTGACCGTGTACATCGGCATGCTGGGGGAGCCCAAGTACGTCAAGACACCGGAAGGCCTCAAGCCCCTGGACTGCTTCTATCTGAAGCTGCATGGTG

TGAAG - UNI32388 - CTAGAGGCCCTGAACCAGTCTATCAACATTGAGCAGTCACAGTCAGACAGAAGCAAGAGGCCCTTCAACCCCGTCAC GGT

CAATCTTCCCCCTGAGCAGGTCACAAAAGTGACCGTGGGGCGGCTCCATTTCAGTGAGACCACTGCCAACAACATGCGCAAGAAGGGCAAGCCCAACCCT

GACCAGAG GTATTTCATGCTGGTGGTGGCCCTCCAGGCACATGCACAGAACCAGAACTACACACTGGCAGCCCAGATCTCAGAGCGTATCATTGTGCGG

 GCCTCTAACCCAGGCCAGTTTGAAAGTGACAGTGACGTGCTGTGGCAACGGGCGCAGCTGCCAGATACGGTCTTCCACCATGGCCGTGTGGGCATCAAC

ACCGACCGGCCAGATGAGGCATTGGTCGTCCACGGCAACGTGAAGGTCATGGGTTCTCTTATGCACCCTTCCGATCTGCGGGCCAAGGAGCACGTGCAGG

AG GTGGACACCACCGAGCAGCTGAAGAGGATCTCTCGGATGCGGCTGGTGCACTACAGATACAAGCCTGAGTTCGCTGCTAGCGCAGGCATTGAAGCCA

CCGCACCGGAGACAG GTGTCATCGCCCAGGAAGTGAAGGAGATCCTGCCTGAAGCTGTGAAGGACACAGGGGATGTAGTCTTTGCCAATGGGAAAACCA

TAGAGAACTTCCTTGTAGTGAACAAG GAGCGAATCTTCATGGAGAATGTGGGGGCTGTGAAGGAGTTATGCAAACTGACAGACAACCTAGAGACTCGCA

TTGATGAGTTGGAGCGATGGAGCCACAAGCTGGCCAAGCTGCGGCGCCTTGACAGCCTCAAGTCAACTGGCAGCTCAGGGGCTTTCAG CCATGCAGGGA

GCCAGTTTAGCCGGGCAGGCAGTGTCCCCCACAAAAAGAGGCCCCCTAAACTGGCCAATAAG TCATCGCCAGCGGTCCCAGACCAGGCCTGCATCAGTC

AGCGTTTTCTGCAGGGAACTATCATAGCTCTGGTGGTGGTCATGGCCTTCAG CGTGGTGTCTATGTCCACACTATATGTGCTGAGCCTGCGCTCTGAAG

AGGACCTGGTGGATGCTGATGG CTCTCTTGCTGTGTCTACTTCCTGTCTTCTGGCCCTGCTTCGGCCCCAGGACCCTGGGGGGAGTGAGGCCATGTGCC

CATG GTCCAGCCAGAGCTTCGGGACCACACAGCTCCGACAGTCCTCCATGACCACCGGACTACCAGGCACACAGCCCTCTTTGCTGCTGG TTACCAAG

TCAGCCTCGGGTCCAGCTCTCCGTGCCTTGGACCTGTGCTCCAGCCAGCCCTGCCCCATCGTCTGCTGCTCTCCTCCCGTCTCCAGTCCTGCTACAGATC

CTGCCCTTGGCCCCACTCTTACTCCTACTCCAAGCCCCAGCTCTAACCCCAAGCACTCAG GCCCTGGCCAGATGGCCCCACTGCCAGTCACCAACATCA

GAGCCAAATCCTGGGGCATCTCAGCTAATGGCATCAGCTATTCCAAGCATTCCAAGAGCCTGGAACCTCTGGCCAGTCCTGTGGTCCCCTTTCCTGGAGG

GCAGAGCAAGACCAAGAACAGCCCCAGCTTCAATCTCCAAAGTCGAGCCCGCAGAGGAGCCCCGCAACCCAGCCCAAGCCCTGCCCAATTCACACAGACC

CAGGGCCAGCTAG ACCCAGCGCCATCCCTGACCTCCATCCAGCTGCTGGAGAATTCCATGCCTATCACTTCTCAGTACTGTGTGCCAGAAGGTGCTTGC

AG GCTTGGCAACTTCACCTACCACATCCCTGTCAGCAGCAGCACACCACTGCACCTCAGCCTGACCCTGCAGATGAA TTCCTCCACCCCTGTGTCCGT

GGTACTGTGCAGCCTGACATCGGAGGAGGAGCCCTGTGAGGAGGGAGGCTTTTTGCAGAGGTTCCACCCGCATCAGGACACCCAG GGCACCTCTCATCA

GTGGCCAGTAACCATCCTGTCCTTCCGTGAATTCACATACCACTTCCGGGTGACATTGCTG GGTCAGGCCAACTGCAGCTCAGAGGCCATCGTTCAGCC

AGCCACCGACTACTACTTCCACTTCTACCGCCTGTGTGACTGAGCTGCCTCCTGAGGCAGTGCCACAGCCGGGACTGGAGTCCCTGGGCCCTCAACACTG

GATGCAAATGTGTTACACTGGAGCCTGCTGCAGGCCAGCTCTCTGCTCTTCACTGCTTCCCTTGACTGGGGAGACTGGAAGTCCTTACACTGGAGTTGCT

GGGCCAACTGGTCACCCTCACACAGCACAGAGGGGGCTAGAGGGAACAGCCTCCTGGGTCTTCCTTCTGGTCATCTCCTTGGGGCAGCACAGGACCACTT

CATGGCTGTCTAGTTATGGTCCCTGGAGGGCTATTTGCCCACCTTCACTCTCCCTGCCTTCCCTTCTGAGTTGTGGTAGAGCAAAGACCCACAGGGGTTG

GACCCAGACCTCTTAAAACCTGGCTGGACCCCCATGAGTCCACGCAGAGTCAATAACTCACCTGTCATGCTGTTCCCAGGAGGGACAGCTTGGTAGGAAC

TTTCTGGGGTTTGACTGTTACACTAGACATGGATTTCTAAGCTTTAAGTGTGGTTGGTTTAGGAGAGTTTTCCTTGGGAGAGCTAGCCCTGAGGTAGTCA

GGGCTAGCTCCGGATGGCTGGAGAAGCTGACCTTGTGCCTTAAGTCTACTAGTGCCTGATGGAGCCACCCTCATAGGGCTGAACCAGTGGGGCTGACGGG

CCAGGTCAGCCTTGGACCCTTGATCCTGGAGGACCCTGGAAGGGGTGGTTCCCTGTAAGCTCCCAAGATCTATGTTCCTGGGAGTTTCCCAAACTCATGA

TGGAGTTGGTGACAAGAGCAGAGGAGCAAGAATCCCTGCAAGCAGTAGACTGGTTTCCACTGGAGGGTGAATGCAGATACCTTTTATTAACGATATACTT

ACTAAATGCACTTAAACCAGGTACCAAGGAGTAGGACAGAACTGGAAAGCTGAGTGGGCCTCAGTGTGGAGAGGTACTAGTGGACAGGACTTTCATGGCT

TGGGTCCATGCTCCTCCCACACCCAAGAGGAGTGGTGGGTTTGAGTTTGGAGGTTTTACTCAAGTGACAGCTTCAGCATTTCTTGGTAGCACCTACAGCA

TTCTGATTACATGCAGGTTCCTG
Translation
 - UNI15384 -  - UNI15384 - - UNI22237 - - UNI30044 -  - UNI17693 - - UNI30044 -  - UNI17693 - - UNI

30044 -  - UNI25846 -  - UNI32388 -  - UNI32388 -  - UNI32388 -   MLVVALQAHAQNQNYTLAAQISERIIVR ASNPG

QFESDSDVLWQRAQLPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQE VDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPET

G GVIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNK ERIFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGSSGAFS SHAGS

QFSRAGSVPHKKRPPKLANK SSPAVPDQACISQRFLQGTIIALVVVMAFS SVVSMSTLYVLSLRSEEDLVDADG GSLAVSTSCLLALLRPQDPGGSE

AMCPW WSSQSFGTTQLRQSSMTTGLPGTQPSLLLV VTKSASGPALRALDLCSSQPCPIVCCSPPVSSPATDPALGPTLTPTPSPSSNPKHSG GPGQM

APLPVTNIRAKSWGISANGISYSKHSKSLEPLASPVVPFPGGQSKTKNSPSFNLQSRARRGAPQPSPSPAQFTQTQGQLD DPAPSLTSIQLLENSMPIT

SQYCVPEGACR RLGNFTYHIPVSSSTPLHLSLTLQMN NSSTPVSVVLCSLTSEEEPCEEGGFLQRFHPHQDTQ GTSHQWPVTILSFREFTYHFRVTL

L GQANCSSEAIVQPATDYYFHFYRLCD

For any suggestions or comments, please send an email to unitrap@crg.es