Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036168 (Ccdc38)
Chromosomal location
Chr 10: 93003377 - 93047071 (+)
Description
coiled-coil domain containing 38 Gene [Source:MGI (curated);Acc:Ccdc38-001]
RefSeq_dna
NM_175488 
RefSeq_peptide
NP_780697.2 
UniGene
Mm.259642 
MGI
MGI:2444738 
Uniprot/SWISSPROT
Q8CDN8 
Human Ortholog
ENSG00000165972 (CCDC38)
Omim not available
UniTrap UNI32857
Vector Insertion
Chr 10: 93003555 - 93008199
Public Clones IST10280E11 (tigm) IST10984H8 (tigm) IST12660H10 (tigm) IST12015H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23070
Vector Insertion
Chr 10: 93008251 - 93011653
Public Clones IST10357E5 (tigm)
Private Clones OST277435 (lexicon) OST167706 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25764
Vector Insertion
Chr 10: 93011755 - 93012906
Public Clones IST11762F1 (tigm) IST14742B8 (tigm)
Private Clones OST167091 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35222
Vector Insertion
Chr 10: 93013073 - 93018263
Public Clones IST14840F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048345
Sequence
GTGTTCGGTTGGCCAGATCGGCGCTTGGGCCTGGTAGTAAGCGGTTCCCAGGATGAAGGGAGCCTGGAGCAGGGAAGGATGAAGCTGAGACACAGAGTAT

CAGTTTGGTGCCTCTGTCTGCTTTGTCCCGACCGCCTTCTTGAAGGATAGGTCTCAACAGTGATCCAGACTTGTTGAG - UNI32857 - GACCAGGA

GACAAAATGGCATCCCAGATGCACACATCAATAAGTTCTGGAG - UNI23070 - ATGAAGGAAAAGATGCTGTACTCAAAAAGGAAAGACCCTACAA

GATTTTTTTCAAAGATCTCTTCGTTTTCAAAGAAAATGAAATTGCTGCCAGGAAAAAG - UNI25764 - GAGAGAATGAAAAACCACAGCATGAAAA

TCTACCAGAAGACAACATTTTCGTCCCGAATGAAGAGTCGCTCACACCTTGGCCAGCTAGCTTTTTTCGCTGACGCAGGCAGCTCCTCCTATGAACGTCT

GGGGCTAGATCCCACTCTTATTCTCAGGCTGACAGAAG - UNI35222 - GTGCAGACAGAAAGAGGACGGTCCACGAGTTTATTAACGACCAAAGAG

ACAGATTTCTACTTGAG TATACAGTGTCAACCAAGAAAAAGACAATCAAAAGGTTTGAAAGACTCATAGCCATTAAAGAAAATCAACTCAAAAAAGCTG

AGAAAAAGCTCCAAGATGACGCATTGTCCTTTGAAGAATTCCTACGAGAAAATGACCAGAGATCTGTAGATGCTCTCAAAAT GGCAGCACAAGAAACAA

TAAACAAGCTCCAAATGACATCAGAGCTCAAGAAAGCAAGCATGGAAGTTCAATCAATAAAGAG TGATATAGCAAAAACAGAGTTCCTCCTCAAGGAAT

ACATGAAATATGGATTCTTCCTGCTGAAGTTGTCCCCAAAACAATGGCAAATACAGCAATCGCAAAAAAGGGCCCAGTCGTCCAAAAGCAACCACATTCT

TCCAAAAATCTTGGAAA AATTCTCCATAAATACAGCTAAAGGAGATAACAGCATCGACTCAGACAAGATGTCAGTTTCAGAAGAATGGAGTTCAAGGCG

AGGAAGCCAAG GAGGAAGACACGGGAAACATACTTTGGGCCAAGACTCTAGGAAGTCATCTGGGTTCAC TCGTCCTGAAAGCATGGCCTCCGAGGACA

GTTTGGAGTACTTTCTAGAGGACGAGCTCGTGGAGTTTGATCTG CTGCCAGAGATTTATTTCAAGGAGCCAGAGGAGTTGCTGCAGGTCTTCACGGAGC

TGGAAGAGCAGAACCTCACCTTGGTTCAGTATTCCCAAGATGTGGATGAGAATCTCGAAGATGTCAACAAAAGAGAAAAATTTATACAGGATAAGAT AA

ACAACAACATCTCCTTCCTGCTGGAGCACAAACATATGCTCAGGATGAACTGTGAACGAGAGGAGGAGAAGGCAGCAGAGCTGGAGCTGAGGTCCAGGCT

CTTCAGTTTTGGAGAATTCAATTCCGATGCTCAG AAGCAGGCAATCCTGAGGCAGGAGCCTACATGGAAAGCGATTTACTTTGCTGAGAAGTTTATTGA

GTTCCTCTTGAGGAGTATCAGCCAGCCCGTGGCGAAAAAGGATCCCTTTCATCTCCCGAAATACATTATCTACCAGCTCAAGAGACTGCAGAATCAAGTA

AAACATCGAAGTGGCGAG GAAAAGCTAATAGACTCTCTTAGTAAAAAGATCAATCAAGTGTATAGAGTCTGCATCGGAGATGCTGAGGTTGGCAGCTTG

AATGCAGTTCAAAAACTGGTCAAAGTAGAGTCTCGCCTGGTGGAGCTGAGCGACCTCATTGAATCTATTCCCAGAGAACACGTGGAAGCGATCGAAAGGC

TCAAACAGAAGGAGCGACGGCAAAA GCTGCGTGAAGAGAAGATGAAGGAAAAGCAGAGACACCAGGAGGAGCGGCTAAAAGCTGCTCTGGAAAGAGCAG

TGGCACAACCCAAGAAGAAG TTGGGAAGACGACTTATCTACCGTTCGAAACCTCAATCTGCAGACAAACAAGAGCTCCTTTTAGTCAGTGATACAAGAT

CAAAATCACAGGACGAAGAGTACTTTTTTAGTTGAACGGGATCACGAGGATACTTTCTTAGCGAATGTTTTATGTGGATGTTGGCTTTCAGTGATGCAAT

ACTGCCCTAGCAAATTCCAGGGCCGCAGCAGACCTTTAGCTGGAAGTTTACAGGACTAGGAACAGCAACTATTTTCTGCTGCAACTCTATTGTTCACTAG

TACAGGCCATGAGCTAAGCAATACTTACTTTAGGTTGTCCCTGTTGGAGACATGTATCCAAAGTCAATTTATTGATGTAACAATAGAATGGCCTTCCTCA

AAGCATGAGAATTTTAATATTTTCTAAAGCAATAAGGAAGTTTACAGCTTTGAATATACATTTTTAAAATGTATTATTCTTAAAACAACTGGACAGGTTT

AAAGCTTAAAAACTAATAGACTACGGTCTCAGAACAATCATGGGGCTGGTTTTCTTTCACATTAAGCTCTGAAAACCTTATCAGAAAACTTTCAAGTGAA

CAAAATCATACATCTTCAGCCTAAATATCAATTTGTATTGTATTTTATCTCCATAATTATTTCAATTTTCATGTTTTGACTTAGCTATAATATACATTAT

TTAGTCTATGTCAATATAGAAATAATGATTTATTAATACAATATATATTAATACTAAGAAAATGTTTAACTTTATGGATGTTACAAGTGGTTTGGAAACC

TTAAACAACACTGCTGCTTTTATGAGGTCTCAGTTAAACCAGCGGTGGGATTACAAAAAAAAAAAAAGAGTCCCTTGAATAAAACTGAGAGGCTTTTAAA

ACTTTAGTTCTAAGAATTATCCATCCATTGTTTCAACATTTGCGCTTTGCATTAAATAGTCCACAAGTCAAGTTGAAAAAAAAGAACCCCAAATCTTTAT

TGTATAGAAATACATATATATATAAAAAAAAAAATCCAAGATGCTATTCTCTCATTTCCCCATCTTCCTCTTCTTCTTCAACGCCTCTGATGTAGAGGAC

ATTATTACACCTGTAACAGAAAACAGTCCATTGTGAGCTGCACTCAGAACCCACACAAGATCAATCCTCAGTGCCCCATCATCAGACTGGACACTGAACT

CACAGCTTGCCACTTGTCCTGTTAGTCCTGTATAGGTGTAGTAAAGACACACCACACATTTTTACCATCATCACACTTCATCTCTACGACTTAGAATGTA

GGTAGTTGCTGATACCAGACAGTGAGTACAACAGAAATCCTTAGCAGCCAGACTCAACTAAAATTCAAATTTAAATCCCTGTAACCCAGGACACTGATAC

AGGTTACAGCTGGAGCCAGGAGATGTAAATCAAGAGTAGGAAAATCTCAAATATAAACTGAAATCTTCCAACATGTTAGTGATTTCACAAGCTTCTGAGA

TCTAGTTGTAGAGTACTTCCTGTTTAATGTTTAATAGGACTAATATATTTCAGCAGGTATTTCTGAGGTTAGTTAGAACTCCTTTCATACACACAAATAA

GTCTGTTACCTTATTAGAACTTCGCCCAGATGTCCAGACAGCGCCCCATCTATGTACTCTTCTGTATTTGCAAGCTTTAGACAAAAAGAAAGGTATTAGT

ATAGCTGCACGGGAGGGAAGAGTGCAGCATGCCTACTCGGTGAGGACCCAGTGACTGAGACTCCTCCACACCAACAACTCACACTGGATCCATAAACAGT

AGCTCTAAGATTATCTTCCCATCACTCTTGTAGCTTTGGATTTCATATATTCATTAAGACATGCATGGGTATAGAACTCATGGATAATAAAGCTCGTTTC

AAAGTT
Translation
 - UNI32857 - MASQMHTSISSGD - UNI23070 - DEGKDAVLKKERPYKIFFKDLFVFKENEIAARKK - UNI25764 - ERMKNHSMKIY

QKTTFSSRMKSRSHLGQLAFFADAGSSSYERLGLDPTLILRLTEG - UNI35222 - GADRKRTVHEFINDQRDRFLLE YTVSTKKKTIKRFERLIA

IKENQLKKAEKKLQDDALSFEEFLRENDQRSVDALKM MAAQETINKLQMTSELKKASMEVQSIKS SDIAKTEFLLKEYMKYGFFLLKLSPKQWQIQQS

QKRAQSSKSNHILPKILEK KFSINTAKGDNSIDSDKMSVSEEWSSRRGSQG GGRHGKHTLGQDSRKSSGFT TRPESMASEDSLEYFLEDELVEFDL 

LPEIYFKEPEELLQVFTELEEQNLTLVQYSQDVDENLEDVNKREKFIQDKI INNNISFLLEHKHMLRMNCEREEEKAAELELRSRLFSFGEFNSDAQ K

QAILRQEPTWKAIYFAEKFIEFLLRSISQPVAKKDPFHLPKYIIYQLKRLQNQVKHRSGE EKLIDSLSKKINQVYRVCIGDAEVGSLNAVQKLVKVESR

LVELSDLIESIPREHVEAIERLKQKERRQK KLREEKMKEKQRHQEERLKAALERAVAQPKKK LGRRLIYRSKPQSADKQELLLVSDTRSKSQDEEYFF

S
Transcript ENSMUST00000092215
Sequence
GTGTTCGGTTGGCCAGATCGGCGCTTGGGCCTGGTAGTAAGCGGTTCCCAGGATGAAGGGAGCCTGGAGCAGGGAAGGATGAAGCTGAGACACAGAGTAT

CAGTTTGGTGCCTCTGTCTGCTTTGTCCCGACCGCCTTCTTGAAGGATAGGTCTCAACAGTGATCCAGACTTGTTGAG - UNI32857 - GACCAGGA

GACAAAATGGCATCCCAGATGCACACATCAATAAGTTCTGGAG - UNI23070 - ATGAAGGAAAAGATGCTGTACTCAAAAAGGAAAGACCCTACAA

GATTTTTTTCAAAGATCTCTTCGTTTTCAAAGAAAATGAAATTGCTGCCAGGAAAAAG - UNI25764 - GAGAGAATGAAAAACCACAGCATGAAAA

TCTACCAGAAGACAACATTTTCGTCCCGAATGAAGAGTCGCTCACACCTTGGCCAGCTAGCTTTTTTCGCTGACGCAGGCAGCTCCTCCTATGAACGTCT

GGGGCTAGATCCCACTCTTATTCTCAGGCTGACAGAAG - UNI35222 - GTGCAGACAGAAAGAGGACGGTCCACGAGTTTATTAACGACCAAAGAG

ACAGATTTCTACTTGAG TATACAGTGTCAACCAAGAAAAAGACAATCAAAAGGTTTGAAAGACTCATAGCCATTAAAGAAAATCAACTCAAAAAAGCTG

AGAAAAAGCTCCAAGATGACGCATTGTCCTTTGAAGAATTCCTACGAGAAAATGACCAGAGATCTGTAGATGCTCTCAAAAT GGCAGCACAAGAAACAA

TAAACAAGCTCCAAATGACATCAGAGCTCAAGAAAGCAAGCATGGAAGTTCAATCAATAAAGAG TGATATAGCAAAAACAGAGTTCCTCCTCAAGGAAT

ACATGAAATATGGATTCTTCCTGCTGAAGTTGTCCCCAAAACAATGGCAAATACAGCAATCGCAAAAAAGGGCCCAGTCGTCCAAAAGCAACCACATTCT

TCCAAAAATCTTGGAAA AATTCTCCATAAATACAGCTAAAGGAGATAACAGCATCGACTCAGACAAGATGTCAGTTTCAGAAGAATGGAGTTCAAGGCG

AGGAAGCCAAG GAGGAAGACACGGGAAACATACTTTGGGCCAAGACTCTAGGAAGTCATCTGGGTTCAC TCGTCCTGAAAGCATGGCCTCCGAGGACA

GTTTGGAGTACTTTCTAGAGGACGAGCTCGTGGAGTTTGATCTG CTGCCAGAGATTTATTTCAAGGAGCCAGAGGAGTTGCTGCAGGTCTTCACGGAGC

TGGAAGAGCAGAACCTCACCTTGGTTCAGTATTCCCAAGATGTGGATGAGAATCTCGAAGATGTCAACAAAAGAGAAAAATTTATACAGGATAAGAT AA

ACAACAACATCTCCTTCCTGCTGGAGCACAAACATATGCTCAGGATGAACTGTGAACGAGAGGAGGAGAAGGCAGCAGAGCTGGAGCTGAGGTCCAGGCT

CTTCAGTTTTGGAGAATTCAATTCCGATGCTCAG GAAAAGCTAATAGACTCTCTTAGTAAAAAGATCAATCAAGTGTATAGAGTCTGCATCGGAGATGC

TGAGGTTGGCAGCTTGAATGCAGTTCAAAAACTGGTCAAAGTAGAGTCTCGCCTGGTGGAGCTGAGCGACCTCATTGAATCTATTCCCAGAGAACACGTG

GAAGCGATCGAAAGGCTCAAACAGAAGGAGCGACGGCAAAA GCTGCGTGAAGAGAAGATGAAGGAAAAGCAGAGACACCAGGAGGAGCGGCTAAAAGCT

GCTCTGGAAAGAGCAGTGGCACAACCCAAGAAGAAG TTGGGAAGACGACTTATCTACCGTTCGAAACCTCAATCTGCAGACAAACAAGAGCTCCTTTTA

GTCAGTGATACAAGATCAAAATCACAGGACGAAGAGTACTTTTTTAGTTGAACGGGATCACGAGGATACTTTCTTAGCGAATGTTTTATGTGGATGTTGG

CTTTCAGTGATGCAATACTGCCCTAGCAAATTCCAGGGCCGCAGCAGACCTTTAGCTGGAAGTTTACAGGACTAGGAACAGCAACTATTTTCTGCTGCAA

CTCTATTGTTCACTAGTACAGGCCATGAGCTAAGCAATACTTACTTTAGGTTGTCCCTGTTGGAGACATGTATCCAAAGTCAATTTATTGATGTAACAAT

AGAATGGCCTTCCTCAAAGCATGAGAATTTTAATATTTTCTAAAGCAATAAGGAAGTTTACAGCTTTGAATATACATTTTTAAAATGTATTATTCTTAAA

ACAACTGGACAGGTTTAAAGCTTAAAAACTAATAGACTACGGTCTCAGAACAATCATGGGGCTGGTTTTCTTTCACATTAAGCTCTGAAAACCTTATCAG

AAAACTTTCAAGTGAACAAAATCATACATCTTCAGCCTAAATATCAATTTGTATTGTATTTTATCTCCATAATTATTTCAATTTTCATGTTTTGACTTAG

CTATAATATACATTATTTAGTCTATGTCAATATAGAAATAATGATTTATTAATACAATATATATTAATACTAAGAAAATGTTTAACTTTATGGATGTTAC

AAGTGGTTTGGAAACCTTAAACAACACTGCTGCTTTTATGAGGTCTCAGTTAAACCAGCGGTGGGATTACAAAAAAAAAAAAAGAGTCCCTTGAATAAAA

CTGAGAGGCTTTTAAAACTTTAGTTCTAAGAATTATCCATCCATTGTTTCAACATTTGCGCTTTGCATTAAATAGTCCACAAGTCAAGTTGAAAAAAAAG

AACCCCAAATCTTTATTGTATAGAAATACATATATATATAAAAAAAAAAATCCAAGATGCTATTCTCTCATTTCCCCATCTTCCTCTTCTTCTTCAACGC

CTCTGATGTAGAGGACATTATTACACCTGTAACAGAAAACAGTCCATTGTGAGCTGCACTCAGAACCCACACAAGATCAATCCTCAGTGCCCCATCATCA

GACTGGACACTGAACTCACAGCTTGCCACTTGTCCTGTTAGTCCTGTATAGGTGTAGTAAAGACACACCACACATTTTTACCATCATCACACTTCATCTC

TACGACTTAGAATGTAGGTAGTTGCTGATACCAGACAGTGAGTACAACAGAAATCCTTAGCAGCCAGACTCAACTAAAATTCAAATTTAAATCCCTGTAA

CCCAGGACACTGATACAGGTTACAGCTGGAGCCAGGAGATGTAAATCAAGAGTAGGAAAATCTCAAATATAAACTGAAATCTTCCAACATGTTAGTGATT

TCACAAGCTTCTGAGATCTAGTTGTAGAGTACTTCCTGTTTAATGTTTAATAGGACTAATATATTTCAGCAGGTATTTCTGAGGTTAGTTAGAACTCCTT

TCATACACACAAATAAGTCTGTTACCTTATTAGAACTTCGCCCAGATGTCCAGACAGCGCCCCATCTATGTACTCTTCTGTATTTGCAAGCTTTAGACAA

AAAGAAAGGTATTAGTATAGCTGCACGGGAGGGAAGAGTGCAGCATGCCTACTCGGTGAGGACCCAGTGACTGAGACTCCTCCACACCAACAACTCACAC

TGGATCCATAAACAGTAGCTCTAAGATTATCTTCCCATCACTCTTGTAGCTTTGGATTTCATATATTCATTAAGACATGCATGGGTATAGAACTCATGGA

TAATAAAGCTCGTTTCAAAGTT
Translation
 - UNI32857 - MASQMHTSISSGD - UNI23070 - DEGKDAVLKKERPYKIFFKDLFVFKENEIAARKK - UNI25764 - ERMKNHSMKIY

QKTTFSSRMKSRSHLGQLAFFADAGSSSYERLGLDPTLILRLTEG - UNI35222 - GADRKRTVHEFINDQRDRFLLE YTVSTKKKTIKRFERLIA

IKENQLKKAEKKLQDDALSFEEFLRENDQRSVDALKM MAAQETINKLQMTSELKKASMEVQSIKS SDIAKTEFLLKEYMKYGFFLLKLSPKQWQIQQS

QKRAQSSKSNHILPKILEK KFSINTAKGDNSIDSDKMSVSEEWSSRRGSQG GGRHGKHTLGQDSRKSSGFT TRPESMASEDSLEYFLEDELVEFDL 

LPEIYFKEPEELLQVFTELEEQNLTLVQYSQDVDENLEDVNKREKFIQDKI INNNISFLLEHKHMLRMNCEREEEKAAELELRSRLFSFGEFNSDAQ E

KLIDSLSKKINQVYRVCIGDAEVGSLNAVQKLVKVESRLVELSDLIESIPREHVEAIERLKQKERRQK KLREEKMKEKQRHQEERLKAALERAVAQPKK

K LGRRLIYRSKPQSADKQELLLVSDTRSKSQDEEYFFS

For any suggestions or comments, please send an email to unitrap@crg.es