Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036246 (Gmip)
Chromosomal location
Chr 8: 72332586 - 72345768 (+)
Description
Gem-interacting protein Gene [Source:MGI Symbol;Acc:MGI:1926066]
Human Ortholog
not available
Omim not available
UniTrap UNI35371
Vector Insertion
Chr 8: 72335540 - 72337514
Public Clones IST13328E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036074
Sequence
ACCACTGGGTCGGCAGAGGCAGGAAATCGGGCTGGTCCCGGGCGGCGCGCAGCCCTGTCCCTTTCTCAGCATTGCCGCGCGTTCCCCACCCCACCCCCTG

CCCCCGGGCATCGCCATGGACTCAGCGGAGACAG AGCTAACCCCAGCTCCTGAGGGCAGGAAGAGATACAGTGACATCTTCCAGAGCCTGGACAACCTC

GAGATATCATTGGGGAACGT AACTTTTGATCCCCTGGCTGGAGACCCTGTACGCAGAGAAGACCTGGAGCCTGACAAAGCTGACACAGCCACAGTGGTG

ACTGAGGAG AACAGTGAAGCCAGTAGTTGGCGGGATCTCTCCCCAGAAGGTCCTGCACCCCTCACAG AGGAAGAACTGGATTTGCGACTCATTCGGAC

CAAGGGTGGTGTAGATGCTGCCCTGGAGTATGCTAAAGCATGGAGCCGCTATGCCAAGGAACTGCTGGCCTGGACAGACAAGAGAGCCAACTACG AGCT

CGAGTTTGCTAAGAGTATCATGAAGCTCGCTGAGGCTGGCAAGGTGTCCATTCTCCAGCAG AGCCAAATGCCACTCCAGTACATCTACACCTTGTTTCT

GGAGCATGACCTCAGCCTGGGAGCCCTGGCCCTGGAGACAGTGGCCCAACAGAAGAGAGACTACTACCAG - UNI35371 - CCTCTGGCGGCCAAAA

GGATGGAAATTGAGAAGTGGAGGAAGGAATTCAAGGAACAGTGGCTGAAGGAGCAGAAGCGCATG AATGAGGCAGTGCAGGCACTGCGGCGCTCCGAGC

TCCAGTACATTCAACGCAGAGAGGACCTGAGGGCACGCTCCCAGGGGTCCCCTGAGGACCCTCCTTCCCAGGCATCTCCTGGATCCAACAAGCAACAGGA

GCGCAGACGGCGCTCCCGAGAGGAGGCACAGGCCAAG GCGCATGAGGCGGAGGCTCTGTACCAGGCCTGTGTCCGGGAGGCCAATTCTCGCCAGCAGGA

TCTGGAGACCACCAAGCGGCGGATAGTGTCACATGTGCGCAAGCTGGTGCTGCAAGGAGACGAAGTGCTTAGGCGG GTGACGCTGGGTCTGTTTGAGCT

GCGAGGGGCGCAGGCAGAGCGAGGACCCCGCTCCTTCTCTGCTCTGGCTGAGTGCTGTGTGCCCTTTGAACCTGGCCAGCGCTACCAGGAGTTTGTTCGG

ACACTGCAGCCTGGGGCCCCACCGCCGCCATCTCCGGCCTTCTGCTTCCAGGAGTTCACAGCTGTGGTGCACAG TTTCCCTCAGGACACAAAAAAGAAG

TTTTCGGGGCCTCTACCTCCAAGGCTGGAGGAGGAGGGTTCCCCTGAGCCTGGCCCTTGGGAGGTTGCCAGCTTAGGCAGCCAGG GAATCCCAGGCAGT

GATGTGGACAGTGTAGGTGGTGGCAGTGAGTCCCGGTCTTTGGATTCTCCCACTTCCAGCCCAG GTGCTGGGGCCCGCCGACTTGTAAAGGCTTCGTCC

ACAGGCACGGAGTCCTCCGATGACTTTGAGGAGCGAGACCCTG ATCTGGGGGATGGGATAGAGAATGGAGTAGGCAGCCCGTTCAGGAAGTGGACACTG

TCCACAGCTGCTCAAACCCACCGACTGCGGCGGCTGCGGGGCCCAGCCAAGTGCAGAGAATGTGAAGCCTTCATGGTCAGCGGGACAGAATGTGAAGAG 

TGCTTTTTGACCTGTCACAAGCGCTGCCTGGAGACCCTCCTCATCCTTTGTGGACACCGGCGGCTTCCGGCCCGGATGTCCCTCTTTGGGGTTGACTTCC

TACAGCTCCCCAGAGATTTCCCTGAGGAGGTTCCCTTTGTGATTACCAGATGCACAGCTGAGATAGAGCACCGTGCCCTGGGCTTGCAG GGTATCTATC

GGGTCAGCGGGTCTCGGGTACGTGTGGAGCGGCTGTGCCAGGCCTTTGAGAATGGCCGAGCACTGGTCGAGCTGTCCGGGAACTCTCCTCACGATATCAC

CAGCGTTCTCAAGCGATTTCTTCAGGAG CTCACTGATCCCGTGGTCCCCTTCCACTTGTACGACGCCTTCATCTCTCTGGCAAAGACCCTGCATGCAGA

CCCTGGGGACGACCCTGGGACCCCCAACCCCAGCCCTGAGATTATTCGCTCGCTGAAGACCCTCTTGGTGCAGCTGCCTGACTCTAACTACAGTACCCTG

CGACACCTGGTGGCCCATCTGTTCAG GGTGGCTGCTCGGTTTGAAGAAAACAAGATGTCTGCCAACAATCTGGGAATTGTATTTGGGCCTACACTGCTG

CGGCCACCAGATGGACCCAGGGCCACCGGTGCCAGCCCTGTGGCCTGTCTGCTGGACTCCGGTCACCAGGCTCAGCTGGTTGAGTTCCTCATTGTGCACT

ATGAGCAGATCTTTGGAATGGATGAGCTCCCTCTGGCCTCGGAGCCTCTGACCCAAGACCCTGGCTTGGCTCCTGCATGCCTTGAATCCAGTCCCCAGCA

CCCAGCCTCACTTCTTGCCCAAGACACACAGCCCCTGACCATAGCCTTGGATTCCAGCCCAGACCCCAAACACCACAGTGCCTTGGAGAAGTGCCCCGAG

GTCACACCTCCTGAG CTTGCAACTCTGCAGAGGGACCAGAGGGAGGAGGAGGTGGAAGACACCAGAGATGGGGCAGGGGATG GGTCCAGCCACTGCCC

TGAGGACTTGGCCCTGGGAGCACAATCCCGGGGCCACTTCAGCCGCCAGCCAGTGAAGTATTCCCGGGGAGGTGTGAGGCCAGTTACTCATCAACTCTCC

AGCCTGGCTCTGGTGGCCTCCAAGCTGTGTGAGGAGACTCCTGTCACTGTCTCAGCAGTGCACCGAGGTAGTTTGAGGGTACGAGGTTTGGGCCCTGCTG

CTGCCTGCCCTGAAGGCAGCCCCCTGCGCCGGAACCCTCTGCCCAAGCACTTTGAGATCACCCAGGAGACAGCCCGACTTCTCTCCAAGCTGAACAGTGA

TGCTGTGTCCAGGACCACCTGTTGTGCTGACCCAGAGCCTGAGGAGTCTGAAGAGCACCTCTGACCACCTACCATCCTGAGGGACCCAGAACTGAATTGA

TGGTCCCTGACCCAACCTGGTGACCAAACCAATTCAGTGGGGTGTGGGGAGAGACGGGGTTACCAGTGAGTTCCGGTAATGAAGATTACCTACCTGTGGG

AGTCCCAAGACACTTGGTTGAAGTGTCCCATCATCTCCCTGCCAGAGGAGATTTAAACAGCTAGGCAACACAGGTGCAGGTGTTTCGGGGTCAAGACTCA

ATGGTCAATACAGATCAGTAGATCCTTGGGGACTACCCGAGTCTCTGACCTCTGAGACGGGTGTCTTGACTATTTCAGTCATAATGGCTCCTGGCCCTAC

TACACTTGCAGCAGTAACAGACTCCCAAGTTAGCAGGTGGCTGCAGCCCAGCCCTGTCTCCTTTTAATTTGTTTGTTTGTTTGTTTGTTTTAAGCTAAGT

CTCACTGTGTAGCTCTGGCTGGTCTGGAGCTCCCTTTGTGAGCCACAAATCCTCTGCCTCCCAAGTGCTGGCTAAATCTGTGTTCTTACAACCTCCAAAT

AAAACCATATCCTGCTGCCGGCAGGAGGGCTGACCGCAGTGGTGCTTGCTGTAAAGCCTCACATTTGTTGGACCTCCCAGAGCCACTTAGTGGAAGGAGA

GAGCCCATCCCTACAAATTGTCTGACCTGTGCACATGCACAAATAAAAGAAAATTTTAATTTAAAAAAAAAAATCCGCTGGGCGGTAGTGCCACACACCT

CTACTTGATCCTAGCACTCAGGAGATAGAGGCAGGAGGATCTCTGAGTTTTATGCCAGCCAGGTGTACAGAGAAAGTTCCAGGACAGCCAGGGCTACACA

GAGAAACCCTGTTTCAGAAAAACAAAATAAAATAAGATAAATCTTGTCTGTTCTTGC
Translation
MDSAETE ELTPAPEGRKRYSDIFQSLDNLEISLGNV VTFDPLAGDPVRREDLEPDKADTATVVTEE NSEASSWRDLSPEGPAPLTE EEELDLRLIR

TKGGVDAALEYAKAWSRYAKELLAWTDKRANYE ELEFAKSIMKLAEAGKVSILQQ SQMPLQYIYTLFLEHDLSLGALALETVAQQKRDYYQ - UNI3

5371 - PLAAKRMEIEKWRKEFKEQWLKEQKRM NEAVQALRRSELQYIQRREDLRARSQGSPEDPPSQASPGSNKQQERRRRSREEAQAK AHEAEAL

YQACVREANSRQQDLETTKRRIVSHVRKLVLQGDEVLRR VTLGLFELRGAQAERGPRSFSALAECCVPFEPGQRYQEFVRTLQPGAPPPPSPAFCFQEF

TAVVHS SFPQDTKKKFSGPLPPRLEEEGSPEPGPWEVASLGSQG GIPGSDVDSVGGGSESRSLDSPTSSPG GAGARRLVKASSTGTESSDDFEERDP

D DLGDGIENGVGSPFRKWTLSTAAQTHRLRRLRGPAKCRECEAFMVSGTECEE CFLTCHKRCLETLLILCGHRRLPARMSLFGVDFLQLPRDFPEEVP

FVITRCTAEIEHRALGLQ GIYRVSGSRVRVERLCQAFENGRALVELSGNSPHDITSVLKRFLQE LTDPVVPFHLYDAFISLAKTLHADPGDDPGTPNP

SPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFR RVAARFEENKMSANNLGIVFGPTLLRPPDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFGMDE

LPLASEPLTQDPGLAPACLESSPQHPASLLAQDTQPLTIALDSSPDPKHHSALEKCPEVTPPE LATLQRDQREEEVEDTRDGAGDG GSSHCPEDLALG

AQSRGHFSRQPVKYSRGGVRPVTHQLSSLALVASKLCEETPVTVSAVHRGSLRVRGLGPAAACPEGSPLRRNPLPKHFEITQETARLLSKLNSDAVSRTT

CCADPEPEESEEHL

For any suggestions or comments, please send an email to unitrap@crg.es