Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036309 (Skp1a)
Chromosomal location
Chr 11: 52045539 - 52060360 (+)
S-phase kinase-associated protein 1A Gene [Source:MGI (curated);Acc:Skp1a-002]
Mm.371782 Mm.402382 
Human Ortholog
ENSG00000113558 (SKP1A)
Omim not available
UniTrap UNI2822
Vector Insertion
Chr 11: 52045621 - 52045690
Public Clones AG0371 (sanger) CSH767 (baygenomics) CSE105 (baygenomics) A008B05 (ggtc)
(ggtc) P096D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38257
Vector Insertion
Chr 11: 52046115 - 52050338
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10878
Vector Insertion
Chr 11: 52050338 - 52050436
Public Clones D021A06 (ggtc) CMHD-GT_535D12-3 (cmhd)
Private Clones OST318093 (lexicon) OST313547 (lexicon) OST252819 (lexicon) OST248877 (lexicon)
OST130679 (lexicon) OST7092 (lexicon) OST1441 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30311
Vector Insertion
Chr 11: 52050436 - 52051752
Public Clones (sanger) D021A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25907
Vector Insertion
Chr 11: 52051836 - 52056088
Public Clones IST14171D7 (tigm)
Private Clones OST152564 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14174
Vector Insertion
Chr 11: 52056163 - 52057116
Public Clones CMHD-GT_12.2C9-3 (cmhd)
Private Clones OST207897 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23551
Vector Insertion
Chr 11: 52057261 - 52058482
Public Clones not available
Private Clones OST253723 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9066
Vector Insertion
Chr 11: 52058624 - 52059486
Public Clones XK187 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093121




Transcript ENSMUST00000109072




















Transcript ENSMUST00000037324









 - UNI2822 - - UNI10878 - MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLED - UNI10878 - - UNI25907 - - UNI30311 - D



For any suggestions or comments, please send an email to