Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036352 (Ubac1)
Chromosomal location
Chr 2: 25854068 - 25877231 (-)
Description
ubiquitin associated domain containing 1 Gene [Source:MGI (curated);Acc:Ubac1-001]
RefSeq_dna
NM_133835 
RefSeq_peptide
NP_598596.1 
MGI
MGI:1920995 
Uniprot/SWISSPROT
Q8VDI7 
Uniprot/SPTREMBL
A2ARK9 A2ARL0 A2AHB3 
Human Ortholog
ENSG00000130560 (UBAC1)
Omim not available
UniTrap UNI27181
Vector Insertion
Chr 2: 25871937 - 25876916
Public Clones not available
Private Clones OST67721 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8972
Vector Insertion
Chr 2: 25863474 - 25864380
Public Clones RRE311 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114161
Sequence
GCAAGGGTACAGCTCCTGCCCCTTCAGTGACGGGCGGCGGAGCTGACAGGAGCCGGGGCGGGGCGGCGGCGGCCAGCGAAGGAGCGCACGGCGGCCCGGC

CCCGCCCCTGGTCCTCCCGCCAGCCTCAGTGACCTTCACTGGTTCGGGCGGCGGGTGCAGGCCCGGGCGGCGGCGCGATGTTCGTGCAGGAGGAGAAGAT

CTTCGCGGGCAAGGTGCTTCGGCTGCACATCTGCGCAGCCGACGGCGCCGAGTGGCTGGAGGAGGCGACCGAGGACACATCGGTGGAGAAGCTCAAGGAG

AGTTGCCTCAAACAT - UNI27181 - GGTGCTCATGGGAGCCTAGAAGACCCCAAGAATGTGACCCACCACAAGCTAATACATGCTGCTTCAGAGAG

GGTGCTGAGTGACAGCAAAACGATCTTGGAAGAAAACATCCAGGACCAAG ACGTCTTGTTATTGATAAAAAAGCGTGTTCCTTCTCCACTCCCTAAGAT

GGCTGACGTCTCAGCAGAAGAAAAG AAGAAACAAGAGCAAAAGGCTCCAGACAAAGATGCTATTCTTCGAGCAACGGCAAACCTGCCTGCCTGCAGCAC

TGACCGGACTGCTGTCCAGACCACCATGAGAGAC TTCCAGACAGAACTCCGGAAGATCCTCGTGTCTCTCATTGAGGTGGCACAGAAGCTGTTAGCACT

GAATCCCGATGCAGTTGAATTGTTTAAGAAGGCAAATG - UNI8972 - CTGCTGTGGGAACTAGTGTTGAAGATGAGGAGTCCCGGGATGAGCTCAC

AGAAATCTTCAAGAAGATACGCAGGAAAAAGGAATTTCGAGCAGATGCTCGG GCTGTCATTTCGCTGATGGAGATGGGCTTTGACGAGAAGGAAGTGAT

TGATGCCCTCCGAGTGAACAACAACCAGCAGAACGCTGCT TGTGAATGGCTGCTGGGGGACCGGAAGCCATCCCCTGAGGAATTGGACCAGGGCATCGA

TCCCAATAGCCCTCTCTTTCAGGCCATCCTGGACAACCCAGTGGTGCAGCTGGGTTTGACAAACCCTAAGACATTGCTAG CATTTGAAGACATGCTGGA

GAATCCGCTTAACAGCACCCAGTGGATGAACGACCCAGAGACGGGCCCGGTCATGCTGCAGATCTCTAGGATCTTCCAGACGCTGAATCGCACGTAGGTG

GTACCTACTGTGCTCCTTGGCTGTGCAGTCTCAGCAGTCTGTGAGGCAGTGGGCACAGGGTTCAGCCGGGATCTTGCCTGGACCACAGCTTCTCGGACTC

TCCTTTCCAGACCTAACAGCTTATCAACTTCTGCCACATGGCTTGAAAGTTGCAGTCCTAGCTTCTGACAGGTGTCTACAGAAAGTGGCTGTTGCATTGG

GAAGGTGAATGATTGCTGCCCGTCCCTCCAGATACTCTGCTGGGCTCCTGAAGTGCTACTTGAATTGACCCTTAGGTGTTTGCTTGTGGAGCCCAATGTA

TTTAAAAGAAGGCATGTTCTGATCCAAAGTGTTATGTCAAGTGTGCTAATTTAACCAGACTGACTCACAGATGGCTTCTTTAATAAATAAACCCTTTTCC

T
Translation
MFVQEEKIFAGKVLRLHICAADGAEWLEEATEDTSVEKLKESCLKH - UNI27181 - GAHGSLEDPKNVTHHKLIHAASERVLSDSKTILEENIQDQ

D DVLLLIKKRVPSPLPKMADVSAEEK KKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRD FQTELRKILVSLIEVAQKLLALNPDAVELFKKANA

 - UNI8972 - AAVGTSVEDEESRDELTEIFKKIRRKKEFRADAR AVISLMEMGFDEKEVIDALRVNNNQQNAA CEWLLGDRKPSPEELDQGIDPN

SPLFQAILDNPVVQLGLTNPKTLLA AFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Transcript ENSMUST00000114162
Sequence
GCAAGGGTACAGCTCCTGCCCCTTCAGTGACGGGCGGCGGAGCTGACAGGAGCCGGGGCGGGGCGGCGGCGGCCAGCGAAGGAGCGCACGGCGGCCCGGC

CCCGCCCCTGGTCCTCCCGCCAGCCTCAGTGACCTTCACTGGTTCGGGCGGCGGGTGCAGGCCCGGGCGGCGGCGCGATGTTCGTGCAGGAGGAGAAGAT

CTTCGCGGGCAAGGTGCTTCGGCTGCACATCTGCGCAGCCGACGGCGCCGAGTGGCTGGAGGAGGCGACCGAGGACACATCGGTGGAGAAGCTCAAGGAG

AGTTGCCTCAAACAT - UNI27181 - AAGAAACAAGAGCAAAAGGCTCCAGACAAAGATGCTATTCTTCGAGCAACGGCAAACCTGCCTGCCTGCAG

CACTGACCGGACTGCTGTCCAGACCACCATGAGAGAC TTCCAGACAGAACTCCGGAAGATCCTCGTGTCTCTCATTGAGGTGGCACAGAAGCTGTTAGC

ACTGAATCCCGATGCAGTTGAATTGTTTAAGAAGGCAAATG CTATGCTGGATGAAGATGAGGATGAGCGAGTGGATGAGACTGCCTTGCGGCAGCTCAC

AGAGATGGGCTTTCCTGAGAGCAGAGCCTCAAAGGCCCTTCGGCTGAACCA - UNI8972 - CATGTCAGTGCCTCAGGCCATGGAGTGGCTAATTGA

ACACTCAGAAGATCCAGCTATTGACACACCTCTTCCAGGCCATGCTGCTCAAGCAGGGGCCAGTGCTGCAGCCACTACCTCCTCCACCTCCTCTGAAGCT

GCTGTGGGAACTAGTGTTGAAGATGAGGAGTCCCGGGATGAGCTCACAGAAATCTTCAAGAAGATACGCAGGAAAAAGGAATTTCGAGCAGATGCTCGG 

GCTGTCATTTCGCTGATGGAGATGGGCTTTGACGAGAAGGAAGTGATTGATGCCCTCCGAGTGAACAACAACCAGCAGAACGCTGCT TGTGAATGGCTG

CTGGGGGACCGGAAGCCATCCCCTGAGGAATTGGACCAGGGCATCGATCCCAATAGCCCTCTCTTTCAGGCCATCCTGGACAACCCAGTGGTGCAGCTGG

GTTTGACAAACCCTAAGACATTGCTAG CATTTGAAGACATGCTGGAGAATCCGCTTAACAGCACCCAGTGGATGAACGACCCAGAGACGGGCCCGGTCA

TGCTGCAGATCTCTAGGATCTTCCAGACGCTGAATCGCACGTAGGTGGTACCTACTGTGCTCCTTGGCTGTGCAGTCTCAGCAGTCTGTGAGGCAGTGGG

CACAGGGTTCAGCCGGGATCTTGCCTGGACCACAGCTTCTCGGACTCTCCTTTCCAGACCTAACAGCTTATCAACTTCTGCCACATGGCTTGAAAGTTGC

AGTCCTAGCTTCTGACAGGTGTCTACAGAAAGTGGCTGTTGCATTGGGAAGGTGAATGATTGCTGCCCGTCCCTCCAGATACTCTGCTGGGCTCCTGAAG

TGCTACTTGAATTGACCCTTAGGTGTTTGCTTGTGGAGCCCAATGTATTTAAAAGAAGGCATGTTCTGATCCAAAGTGTTATGTCAAGTGTGCTAATTTA

ACCAGACTGACTCACAGATGGCTTCTTTAATAAATAAACCCTTTTCCT
Translation
MFVQEEKIFAGKVLRLHICAADGAEWLEEATEDTSVEKLKESCLKH - UNI27181 - KKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRD FQT

ELRKILVSLIEVAQKLLALNPDAVELFKKANA AMLDEDEDERVDETALRQLTEMGFPESRASKALRLNH - UNI8972 - HMSVPQAMEWLIEHSED

PAIDTPLPGHAAQAGASAAATTSSTSSEAAVGTSVEDEESRDELTEIFKKIRRKKEFRADAR AVISLMEMGFDEKEVIDALRVNNNQQNAA CEWLLGD

RKPSPEELDQGIDPNSPLFQAILDNPVVQLGLTNPKTLLA AFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Transcript ENSMUST00000036509
Sequence
GCAAGGGTACAGCTCCTGCCCCTTCAGTGACGGGCGGCGGAGCTGACAGGAGCCGGGGCGGGGCGGCGGCGGCCAGCGAAGGAGCGCACGGCGGCCCGGC

CCCGCCCCTGGTCCTCCCGCCAGCCTCAGTGACCTTCACTGGTTCGGGCGGCGGGTGCAGGCCCGGGCGGCGGCGCGATGTTCGTGCAGGAGGAGAAGAT

CTTCGCGGGCAAGGTGCTTCGGCTGCACATCTGCGCAGCCGACGGCGCCGAGTGGCTGGAGGAGGCGACCGAGGACACATCGGTGGAGAAGCTCAAGGAG

AGTTGCCTCAAACAT - UNI27181 - GGTGCTCATGGGAGCCTAGAAGACCCCAAGAATGTGACCCACCACAAGCTAATACATGCTGCTTCAGAGAG

GGTGCTGAGTGACAGCAAAACGATCTTGGAAGAAAACATCCAGGACCAAG ACGTCTTGTTATTGATAAAAAAGCGTGTTCCTTCTCCACTCCCTAAGAT

GGCTGACGTCTCAGCAGAAGAAAAG AAGAAACAAGAGCAAAAGGCTCCAGACAAAGATGCTATTCTTCGAGCAACGGCAAACCTGCCTGCCTGCAGCAC

TGACCGGACTGCTGTCCAGACCACCATGAGAGAC TTCCAGACAGAACTCCGGAAGATCCTCGTGTCTCTCATTGAGGTGGCACAGAAGCTGTTAGCACT

GAATCCCGATGCAGTTGAATTGTTTAAGAAGGCAAATG CTATGCTGGATGAAGATGAGGATGAGCGAGTGGATGAGACTGCCTTGCGGCAGCTCACAGA

GATGGGCTTTCCTGAGAGCAGAGCCTCAAAGGCCCTTCGGCTGAACCA - UNI8972 - CATGTCAGTGCCTCAGGCCATGGAGTGGCTAATTGAACA

CTCAGAAGATCCAGCTATTGACACACCTCTTCCAGGCCATGCTGCTCAAGCAGGGGCCAGTGCTGCAGCCACTACCTCCTCCACCTCCTCTGAAGCTGCT

GTGGGAACTAGTGTTGAAGATGAGGAGTCCCGGGATGAGCTCACAGAAATCTTCAAGAAGATACGCAGGAAAAAGGAATTTCGAGCAGATGCTCGG GCT

GTCATTTCGCTGATGGAGATGGGCTTTGACGAGAAGGAAGTGATTGATGCCCTCCGAGTGAACAACAACCAGCAGAACGCTGCT TGTGAATGGCTGCTG

GGGGACCGGAAGCCATCCCCTGAGGAATTGGACCAGGGCATCGATCCCAATAGCCCTCTCTTTCAGGCCATCCTGGACAACCCAGTGGTGCAGCTGGGTT

TGACAAACCCTAAGACATTGCTAG CATTTGAAGACATGCTGGAGAATCCGCTTAACAGCACCCAGTGGATGAACGACCCAGAGACGGGCCCGGTCATGC

TGCAGATCTCTAGGATCTTCCAGACGCTGAATCGCACGTAGGTGGTACCTACTGTGCTCCTTGGCTGTGCAGTCTCAGCAGTCTGTGAGGCAGTGGGCAC

AGGGTTCAGCCGGGATCTTGCCTGGACCACAGCTTCTCGGACTCTCCTTTCCAGACCTAACAGCTTATCAACTTCTGCCACATGGCTTGAAAGTTGCAGT

CCTAGCTTCTGACAGGTGTCTACAGAAAGTGGCTGTTGCATTGGGAAGGTGAATGATTGCTGCCCGTCCCTCCAGATACTCTGCTGGGCTCCTGAAGTGC

TACTTGAATTGACCCTTAGGTGTTTGCTTGTGGAGCCCAATGTATTTAAAAGAAGGCATGTTCTGATCCAAAGTGTTATGTCAAGTGTGCTAATTTAACC

AGACTGACTCACAGATGGCTTCTTTAATAAATAAACCCTTTTCCT
Translation
MFVQEEKIFAGKVLRLHICAADGAEWLEEATEDTSVEKLKESCLKH - UNI27181 - GAHGSLEDPKNVTHHKLIHAASERVLSDSKTILEENIQDQ

D DVLLLIKKRVPSPLPKMADVSAEEK KKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRD FQTELRKILVSLIEVAQKLLALNPDAVELFKKANA

 AMLDEDEDERVDETALRQLTEMGFPESRASKALRLNH - UNI8972 - HMSVPQAMEWLIEHSEDPAIDTPLPGHAAQAGASAAATTSSTSSEAAVG

TSVEDEESRDELTEIFKKIRRKKEFRADAR AVISLMEMGFDEKEVIDALRVNNNQQNAA CEWLLGDRKPSPEELDQGIDPNSPLFQAILDNPVVQLGL

TNPKTLLA AFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT

For any suggestions or comments, please send an email to unitrap@crg.es