Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036356 (Csgalnact1)
Chromosomal location
Chr 8: 70880694 - 71259034 (-)
Description
chondroitin sulfate N-acetylgalactosaminyltransferase 1 Gene [Source:MGI Symbol;Acc:MGI:2442354]
Human Ortholog
not available
Omim not available
UniTrap UNI35034
Vector Insertion
Chr 8: 71080870 - 71169835
Public Clones IST10322C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000078350
Sequence
CTGGAGGTGGAGCCGAGCCCAGGGCCGCCTCGCAGGAGGGAAAGTTCAGCGGCAGCAGGGGAGCAGCGTAGCCGAGGGATCCGGCTCCGCTGTCTGCAGT

GTTGCCTGGG - UNI35034 - GTTCCTTGAACATGCATGACAGATTGGAGAGTTGCCATGTGGATCTACAGTCCTCAGTGTGAGAAGCTTTAAACAA

TCATTTCTGTGGCTGGAATCTTCAAATGATCTACTTTTTATTGCCTCTGGAGCATAACCAG - UNI35034 - TGGTGGCGCTGAGCTGAACACGGTG

CTAGCAGAAGGGGGCGGTACTTTCCCTCTGGACCCTGACTTGGAAGCCAAGTGCAACTCCAGCGCAGTCACCACCAGAAGCAGATGTGCGAGCGGAACAG

CTGTGCGCCTTTCTTTCTGCCGAG - UNI35034 - GTTCCCTCTCATCTTCAGCATATCAGAAAGGCTATGATGGGAACGAATGAAGGAACTTGGAG

GCTCCACTTGACTGACTGTTTCTGTCTAGAAAATCTTCCCTTGGAAGCAAGAGAGCCGTCTCATGTAATGGCTGACTTCTAAAGACAGGCCATGTTCTAG

AAGGAAATAGGTGAAATTGGTTCTGGGAACTTCAGTGGCACTGTGGTCTAACCAGAAAAGCCCGTGTTGGGGGCCCTTCTGGTGCCCTGGGATGTTGCAT

ACTCTGGACCTGGATGCATGGCCTGCACCTGAGTGAGAATGGTCCGCCGCGGGCTGCTGGGGTGGATTTCTCGGGTAGTGATTCTGCTGGTGCTGCTCTG

TTGTGCCATCTCTGTCCTCTACATGTTAGCCTGCACTCCAAAAGGCGACCAGGAGCAGTTGGGACTGCCACGGGCCAATGGACCCACAGGCAAAGATGGC

TACCAAGCGGTGCTGCAGGAGCGCGAGGAACAGCATCGTAACTATGTGAATAGCCTTAAACGACAGATAGCTCAGCTAAAGGATGAACTGCAGGCACGCA

GTGAGCAGTTCCGCAGTGGGCAGGACCAGGCCAGCGATGCCACCAGCCTGCGCTCAGGCTGGGACCGTGAGCCCAAAGCCCAGGCCGATCTGCTGGCCTT

CCTGCGTGGACAGGTGGACAAGGCCGAGGTACATGCCGGTGTCAAGCTGGCCACGGAGTATGCTGCTGTGCCTTTTGATAGCTTCACTCTGCAGAAAGTA

TACCAGCTGGAGACTGGCCTGACCCGCCACCCTGAGGAGAAGCCAGTGAGGAAAGACAAGCGCGATGAGCTGGTAGAAGCCATCGAATCGGCCCTGGAGA

GTCTAAACAGCCCTGTGGAGAGCAGCCCACACCAGCGTCCTTACACAGCTGCAGACTTCATAGAAG GGATTTACCGAACCGAAAGGGATAAAGGCACTT

TGTATGAGCTGACCTTCAAAGGGGACCACAAGCATGAATTCCAGCGACTTGTCCTATTTCGACCTTTTGGCCCCATCATGAAAGTGAAAAAGGAAAAACT

CAACCTGGCCAACACGCTTATCAATGTTATTGTGCCCCTAGCGAGGAGGGTGGACAAGTTCCGGCACTTCATGCAGAACTTCAG GGAGATGTGCATCCA

ACAGGATGGGAGAGTTCATCTCACCGTTGTTTATTTTGGGAAAGAAGAAATGAATGAAGTCAAAGGAATACTTGAAAACACTTCAAA AGCTGCCAATTT

CAGAAACTTCACCTTCATCCAACTGAATGGAGAATTCTCCCGGGGAAAGGGACTGGATGTTGGAGCCCGCTTCTGGAAGGGAAGTAACGTCCTGCTCTTT

TTCTGTGATGTAGACATCTACTTCACCTCGGAGTTCCTCAACACTTGTAGGCTGAACACACAGCCAG GGAAGAAGGTATTTTATCCGGTTCTGTTCAGT

CAGTATAACCCCGGCGTAATCTACGGCCATCACGATGCAGTCCCTCCGCTAGGACAGCAGCTG GTCATAAAGAAGGAAACAGGATTTTGGAGGGACTTT

GGATTTGGGATGACATGTCAGTACCGGTCAGACTTCATCAACATAG GTGGATTTGACCTGGACATCAAAGGCTGGGGTGGTGAAGATGTGCACCTGTAC

CGGAAATATCTCCATAGCAACCTCATAGTGGTCCGCACACCTGTACGGGGACTTTTCCACCTGTGGCATGAAAAGCACTGTATGGATGAACTGACCCCTG

AGCAGTACAAGATGTGCATGCAATCAAAGGCTATGAATGAAGCATCCCATGGGCAGCTGGGGATGCTTGTCTTCCGGCATGAAATAGAGGCTCATCTTCG

CAAACAGAAGCAGAAAGCCAGCAGTAAAAAGACATGATCTCCTAGGCACAGATTAGCATAGACATTTAATTTTTTTTGCCTTTGGCAGTTGCTGAAGAAG

TAGATGCAACAAAGAGCAACAAAGTATCTGACTGGTGAGGGAGAGATGAAAGAAGAGTCTCATCCCGGGATTCTGTTGGCTCCGTGTATGGTGACGCTGA

CTGTGTTTTCAGCAAATGATCTCTCTGGTTCCTGCTCACTGAAATATTCACAACCTCAGACCAGTTTTGTAGAACGTTTACTAGAATGAGATGCAAACAC

ATTGAATTGGTTACATCAGAGGGCTTTGGTACTACCAGGACTACCAAAGTCTCAGACCAAGCAGAGGATCTATGTGAGAAATGGAGATCTCTGACATTAG

CGTCCTCCAGGAGATAGTGAGCAAAATCAAAGGGCCCTGGAAACACACCATGGAAACTGTAATTTCCCCAGTATTAACCAAAAAAACAAAAAAACAAAAC

CACCACCACCAACAACAAAAAACCCTCTCTTTCCCATTATTGTTTAGTCATCTTTATTCTAAAAATGCACTTTTGTTTTTGCTTCTGAGTGTTATGCTTA

TTTAATTACCCATTTGCAAGCCTTAGTAGGAACATATTGTAGTATATACAATTCTATGATTTTTTAAAAAAGATTTTATTTTAGTTTTTGTTGTTTTTGT

TGATTTGTCTACTTGAGACAGTCTTGTCACAGAGCCCGAGATAAACTTGAAATTATGATCCTCCTGCCTCTGAAGCCTGAGTGCTGAGATTAAAGGTGGG

TGCCACCACAGCTGGCAAGAAGATACATGCAGAGGAGTGGGAGGAAATCCTCTAGTTGCAAGCTCCTGGAGATCTGATCTAAGGACTGGCCAATCTCAGA

CCACGCTAAGGCTATGTGTGGGGTTGGGGAGAGAAAGGTATCAAGAAACTATCTAAGACTGTCCAAAGAGGAACAATCAAACACTGGAGAAAGAAAAAGA

CACTTTCCTCTTCACAAAAAGGACACTAAGAAGCCCTTGGTATATTTACTAGAGAACATAATTTCTCCTCTGGAGAAGTGGGGACCACTTTCTTACCTGT

TTGAATAAACCAAAGTTATGAACCAAACAATCACTTTTCAAAACAGGGTGCTCTTCTTGGTCTCTGGTTTGCATAAGAAGAAAACGCAGGAAATATATAT

CTAAATATATATTTTGAAAGACCAATCCGTTAATCTAGTGAGACGGAAGATTTTGCTACATTTCCATTCACTCCTGGCTATGTGGGAGCAACTTATTTTT

AAAATAAGCAATGTTACTGATTGCTGGGACGTTTCTGAAGCATTTTCTTATAACTCCAAATTCTTTTTTTTTAAATAATAAAATCTGATTAACATTGAGT

GGTTTCTACATCCATATGCAAACTATTTATTTATTAGCCAGCACCGGATGCATGAGCTGATCATCTCTCCTGTCTCTGTGCCTTCTGTCTGCCCACAGTG

AACTCATTGTTGAAATGCTTCAAGAACACTCAAGCTGTGTGTTATAAAAAAAAAAAAAGGAAAAAGAGCATTGTATTGATTTGTACTGGTAGTTTATAAA

ATTTAATTAAAACACAAGACATGAATGGAAGGTGGCATTGCACAGCTAATAAAATCTGTGAATTTG
Translation
 - UNI35034 -  - UNI35034 -  - UNI35034 - MVRRGLLGWISRVVILLVLLCCAISVLYMLACTPKGDQEQLGLPRANGPTGKDGYQAV

LQEREEQHRNYVNSLKRQIAQLKDELQARSEQFRSGQDQASDATSLRSGWDREPKAQADLLAFLRGQVDKAEVHAGVKLATEYAAVPFDSFTLQKVYQLE

TGLTRHPEEKPVRKDKRDELVEAIESALESLNSPVESSPHQRPYTAADFIEG GIYRTERDKGTLYELTFKGDHKHEFQRLVLFRPFGPIMKVKKEKLNL

ANTLINVIVPLARRVDKFRHFMQNFR REMCIQQDGRVHLTVVYFGKEEMNEVKGILENTSK KAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLL

FFCDVDIYFTSEFLNTCRLNTQPG GKKVFYPVLFSQYNPGVIYGHHDAVPPLGQQL VIKKETGFWRDFGFGMTCQYRSDFINIG GGFDLDIKGWGGE

DVHLYRKYLHSNLIVVRTPVRGLFHLWHEKHCMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKASSKKT

For any suggestions or comments, please send an email to unitrap@crg.es