Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036368 (AW061290)
Chromosomal location
Chr 17: 80014240 - 80082152 (+)
Description
Regulator of microtubule dynamics protein 2 (RMD-2)(mRMD-2)(Protein FAM82A1) [Source:UniProtKB/Swiss-Prot;Acc:Q8BSE0]
RefSeq_dna
NM_201361 
RefSeq_peptide
NP_958749.1 
UniGene
Mm.293063 Mm.403808 
MGI
MGI:2147043 
Uniprot/SWISSPROT
Q8BSE0 
Human Ortholog
ENSG00000115841 (FAM82A1)
Omim not available
UniTrap UNI27886
Vector Insertion
Chr 17: 80014709 - 80020645
Public Clones not available
Private Clones OST45231 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112443
Sequence
GGCAGTTGCCTCCGAGGCGGCCTGCGGGGCGCTCTGCGGGGCTCAGCTTTCCGGGTCGAGAGAAGCAGGCCCGGAGCCCGGGGCTGAGCAGTGCTGGCGG

CCGGAGGAGGCGGGAGCCCCGGGCCGCTAGCGGCTCCTCCCCCGGCGCCTCCGTTATCTGGGTCAGACACGAAGGCCACCACGCAGGACCTTGGGACCCG

CAGGCTGCACAGGGTTCCACTCGGCCATCCTCTCCTGGCTCGCCCGCTCGCCCGCGGGTCCCGGTTCCCTGGCTCCAGCCCCAGAGAAGCCTGCGCAACG

ACTCCGG - UNI27886 - AAATAAAAGCCCAGAATGCCCCATTCCACAAACAAAGAGCTAATCCTTGGCATCATGGCGGGGACTGCTGGGATCAGCT

TGCTGGCCTTCTGGTACCACAAGGTCCTCAAGCCAAGGACGACCATGAACTTCCCTAAGCTTCTTTCTCTGGGTAAGAAATTTGGTTCACTAACTCTGCC

AGAGGAAAGCCACAGTGCGCAAGGAGCATCGGTGGTCTTTCAAAGGAGGCAACTCCAGATCCTGGAAAAGCTAAACGAGCTACTGACCAACATGGAAGAA

CTGAAGGAGGAAATCAGATTCCTTAAAGAGACAATTCCAAAGCTGGAGGAATGTATACAAGATGAATTCGGAGGGAAGGTGACAGTTCATAAGATCAGTC

CTCAGCACAGAGCGAGAAAAAAGAAGGGGACAACCGTTCAACGCTCAGCAACAAGTAACAGCTCAGAGGAGGCAGAAAGTGAAGGGGG GTATATTACAG

CTAACACGGACACAGAAGAACAGAACTTCCCGTTCCCCAAGGCTCTTAACACACACATAGAGGAGCTAAAGTTGGATGTCCTCCTTCAGAAGGCAGACCA

TTTGCGGACAAATGAGTCTCACAAAATGGAGAGTTTTGAGCTACTCTGTGACCACAAGGAGAAG TTTAGTGAAGAAACTGAGTTTCTGTGGCGCCTGGC

CCGAGCCTATGGAGACATGTATGATCTATCCACAAGTACACAAGAAAAGAAGCATTATGCTAATATTG GAAAAACTTTAGGAGAGAGAGCTATTACCAG

AGCGCCCATGAATGGACACTGCCATCTGTG GTATGCAGTTTTGTGTGGTTATGTATCTGAGTTTGAGGGCTTGCAAAACAAAATTAACTGTGGACATCT

ATTCAAG AAGCATCTAGAAATAGCCATCCAGCTTTTGCCTGAAGAACCCTTATTATATTACCTCAAGGGAAGGTACTGTTATACA GTCTCAAGACTCA

GCTGGATTGAGAAAAAAATGGCTGCTACTCTGTTCGGAGAAATACCATATTCAACGGTTCATGAAGCTTTGCACAACTTCCTTAAG ACTGAAGAACTGC

AACCTGGTTATTCCATGTCCAACTATATGTATACAGCCAAG TGTTATGTTGAACTTGGGGAACCTCAGGAGGCTTGTAAATTCTGTAACTTGGCATTGC

TACTGCCTGTTGTCACCAAAGAG GACAAGGATGCCCATAAAGAGGTGAAGAAAATGATCAGTTCTTTGAAGAGGTAAATAAAAGACCTTATTCTTCAGC

AAACCCAATACCGTCTTCTAGAATTTAACAGATTGTACTTTTATAATGCCTTTCTCCTTAATGTAGAGATTATGTACTCTCATTTGATTTGAAGGTCTAG

CCTTGCCTTCTAGACCCACTGCACTATGAGACAAATCATGTTCTTTGGAGGCAGTACTTACTCTGATGTTAGTATGTAACGATCTCTGGACATGTATACT

TCTTTGTTTATTCATGTCAATATACTACAGACTTTAGAATGTTTGTGTAACCAATACGTAATCTAATAAAATGCACCCTAGCAAATTGTTATTGTTTCAC

TAGACATTATAAAATGATTAATTCATGGTGAAAATGTAAACAATGGGCAGAATTGCTAGAAAAAAAGAAGAACAAGAGAAAAAAAAGCACAGCAAGCGAT

CAGGCATGCAAATAGAGCTGCAATAAAAATACTGTTCCACTGTCAAACTTGGAAGGGTTTTTTCCTCTTTTTAGGAAGTAGCTAATTTTAGCAGTATTAC

TATAAGATAAATGTATTCATATGTTGATAGTGTGAGGGTGTTTTTGCTGCAATCCTCTGGTTAAAATATATCTAAAGCCCCCCCCCAAAATATTAAGTCA

AATCCTGCAGTGTCTCATCATAGAAATAATCCTAAAGAGAAAGCACAGGATATTGATATGAATTCCAACAAGAAAACAGTCGATCATGCTCAAGTTCCAC

TACAGTAGAAATATTTTAATATTAAAAATATATATGCTCAATATGGTGGCACACGCATAAATACCATCTCTTGGGAACAGGAGGAGGTATGATCATGGGT

CCTAAGCCAGCCTGGGTTAAAAAGCAAGAGCCTGTCTCAAAAAAATGTATGATATGATATGATATGATATGATATGATATGGTATGATGTGGTATGATAC

GGGGAAAAGCAGGAAGATCATAAGTCCTACATAGACTAAATAGCAAGACTAGACCAGTGTGGGGTGGGAGGTGGGGGGAGAGAGTGTGTGTGTGTTATAT

GGCAATGTTTGTGAACAAAACAAAATGGTATATAAATGTAAAATCAGATTGTGAAAATATGCCAGAAAATTATTAGTAGAGAATAAACTAAAATAATGAG

TTTT
Translation
 - UNI27886 - MPHSTNKELILGIMAGTAGISLLAFWYHKVLKPRTTMNFPKLLSLGKKFGSLTLPEESHSAQGASVVFQRRQLQILEKLNELLTNM

EELKEEIRFLKETIPKLEECIQDEFGGKVTVHKISPQHRARKKKGTTVQRSATSNSSEEAESEGG GYITANTDTEEQNFPFPKALNTHIEELKLDVLLQ

KADHLRTNESHKMESFELLCDHKEK FSEETEFLWRLARAYGDMYDLSTSTQEKKHYANIG GKTLGERAITRAPMNGHCHLW WYAVLCGYVSEFEGLQ

NKINCGHLFK KHLEIAIQLLPEEPLLYYLKGRYCYT VSRLSWIEKKMAATLFGEIPYSTVHEALHNFLK TEELQPGYSMSNYMYTAK CYVELGEPQ

EACKFCNLALLLPVVTKE DKDAHKEVKKMISSLKR
Transcript ENSMUST00000040368
Sequence
GTGAGTTGAAGTCAGGAAAACCAGATGATGGTGCAAGAAGTCTGCGTTTGACTGAAGGAAGGTTAAAAGTTGTGCCGTGGGGGTGGAG - UNI27886 

- AAATAAAAGCCCAGAATGCCCCATTCCACAAACAAAGAGCTAATCCTTGGCATCATGGCGGGGACTGCTGGGATCAGCTTGCTGGCCTTCTGGTACCA

CAAGGTCCTCAAGCCAAGGACGACCATGAACTTCCCTAAGCTTCTTTCTCTGGGTAAGAAATTTGGTTCACTAACTCTGCCAGAGGAAAGCCACAGTGCG

CAAGGAGCATCGGTGGTCTTTCAAAGGAGGCAACTCCAGATCCTGGAAAAGCTAAACGAGCTACTGACCAACATGGAAGAACTGAAGGAGGAAATCAGAT

TCCTTAAAGAGACAATTCCAAAGCTGGAGGAATGTATACAAGATGAATTCGGAGGGAAGGTGACAGTTCATAAGATCAGTCCTCAGCACAGAGCGAGAAA

AAAGAAGGGGACAACCGTTCAACGCTCAGCAACAAGTAACAGCTCAGAGGAGGCAGAAAGTGAAGGGGG GTATATTACAGCTAACACGGACACAGAAGA

ACAGAACTTCCCGTTCCCCAAGGCTCTTAACACACACATAGAGGAGCTAAAGTTGGATGTCCTCCTTCAGAAGGCAGACCATTTGCGGACAAATGAGTCT

CACAAAATGGAGAGTTTTGAGCTACTCTGTGACCACAAGGAGAAG TTTAGTGAAGAAACTGAGTTTCTGTGGCGCCTGGCCCGAGCCTATGGAGACATG

TATGATCTATCCACAAGTACACAAGAAAAGAAGCATTATGCTAATATTG GAAAAACTTTAGGAGAGAGAGCTATTACCAGAGCGCCCATGAATGGACAC

TGCCATCTGTG GTATGCAGTTTTGTGTGGTTATGTATCTGAGTTTGAGGGCTTGCAAAACAAAATTAACTGTGGACATCTATTCAAG AAGCATCTAGA

AATAGCCATCCAGCTTTTGCCTGAAGAACCCTTATTATATTACCTCAAGGGAAGGTACTGTTATACA GTCTCAAGACTCAGCTGGATTGAGAAAAAAAT

GGCTGCTACTCTGTTCGGAGAAATACCATATTCAACGGTTCATGAAGCTTTGCACAACTTCCTTAAG ACTGAAGAACTGCAACCTGGTTATTCCATGTC

CAACTATATGTATACAGCCAAG TGTTATGTTGAACTTGGGGAACCTCAGGAGGCTTGTAAATTCTGTAACTTGGCATTGCTACTGCCTGTTGTCACCAA

AGAG GACAAGGATGCCCATAAAGAGGTGAAGAAAATGATCAGTTCTTTGAAGAGGTAAATAAAAGACCTTATTCTTCAGCAAACCCAATACCGTCTTCT

AGAATTTAACAGATTGTACTTTTATAATGCCTTTCTCCTTAATGTAGAGATTATGTACTCTCATTTGATTTGAAGGTCTAGCCTTGCCTTCTAGACCCAC

TGCACTATGAGACAAATCATGTTCTTTGGAGGCAGTACTTACTCTGATGTTAGTATGTAACGATCTCTGGACATGTATACTTCTTTGTTTATTCATGTCA

ATATACTACAGACTTTAGAATGTTTGTGTAACCAATACGTAATCTAATAAAATGCACCCTAGCAAATTGTTATTGTTTCACTAGACATTATAAAATGATT

AATTCATGGTGAAAATGTAAACAATGGGCAGAATTGCTAGAAAAAAAGAAGAACAAGAGAAAAAAAAGCACAGCAAGCGATCAGGCATGCAAATAGAGCT

GCAATAAAAATACTGTTCCACTGTC
Translation
 - UNI27886 - MPHSTNKELILGIMAGTAGISLLAFWYHKVLKPRTTMNFPKLLSLGKKFGSLTLPEESHSAQGASVVFQRRQLQILEKLNELLTNM

EELKEEIRFLKETIPKLEECIQDEFGGKVTVHKISPQHRARKKKGTTVQRSATSNSSEEAESEGG GYITANTDTEEQNFPFPKALNTHIEELKLDVLLQ

KADHLRTNESHKMESFELLCDHKEK FSEETEFLWRLARAYGDMYDLSTSTQEKKHYANIG GKTLGERAITRAPMNGHCHLW WYAVLCGYVSEFEGLQ

NKINCGHLFK KHLEIAIQLLPEEPLLYYLKGRYCYT VSRLSWIEKKMAATLFGEIPYSTVHEALHNFLK TEELQPGYSMSNYMYTAK CYVELGEPQ

EACKFCNLALLLPVVTKE DKDAHKEVKKMISSLKR

For any suggestions or comments, please send an email to unitrap@crg.es