Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036452 (Arhgap26)
Chromosomal location
Chr 18: 39152799 - 39535939 (+)
Description
Rho GTPase activating protein 26 Gene [Source:MGI (curated);Acc:Arhgap26-001]
RefSeq_dna
NM_175164 
RefSeq_peptide
NP_780373.3 
UniGene
Mm.398146 Mm.329396 
MGI
MGI:1918552 
Uniprot/SPTREMBL
Q8C1Q3 A7XUR6 Q3U860 Q9D0J3 Q6ZQ82 
Human Ortholog
ENSG00000145819 (ARHGAP26)
Omim 607785 - JUVENILE MYELOMONOCYTIC LEUKEMIA  
UniTrap UNI26126
Vector Insertion
Chr 18: 39153284 - 39257283
Public Clones (ggtc) IST14619B2 (tigm)
Private Clones OST135790 (lexicon) OST33122 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36579
Vector Insertion
Chr 18: 39387088 - 39389544
Public Clones IST11625F4 (tigm) IST11889D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060850
Sequence
ACCTCCTCCATCCTTGCTACCCCTCGGGGCTGGAGAGTTTCATCTCTAAAATGTTGCTCCACCGGCAATGGAGAACATGTGCGGGAACTCATAGCCACCC

CTGCCTGGGCTGAAACCTGGCTCTGCTGGAGTTTCTCCTGGATCCCCGGCATTGAGCCTCCAAGAGCACATGTTGGTCGTCATATCTGCGAGCCCTTGGT

CTCTTCCTACTTGCAAGCACTCTGTCCAGGAAAGGTCCTTCTGCCCAGGCCCAGGTGTTGTAATTCCCAG CACACCATTCCGGAAGGCAAAGGCTTTGT

ACGCCTGCCAAGCTGAGCACGACTCGGAGCTCTCCTTCACAGCGGGCACCGTCTTCGATAATG TTCATCCATCTCAGGAGCCTGGCTGGTTGGAGGGGA

CTCTGAATGGAAAGACTGGCCTCATCCCAGAGAACTACGTGGAATTCCTCTAACCTTGAGCCCCAGTGGAGCTGCTGAGCTTCACGTGGTCTCCATGACA

ACTGCTGCTTCTGGTGTTGTGGGCCACTTTTCATTGCCACTGAGAAAGCAGGGAGCCCGACTGTTGCTTCCTGCCAACACAAATGCATCTGGGAACGTGT

GCCACCATTCTCCATGATCATCTCAGCTTACAGCACAGTAATGCTGCAAGAACTGCACAGCAATCAGCAGAGGAGGCCATTGGATTTTGATAACCCAGAG

GAAGGCTTGCAAAGCTGTCTTCTCACGAGTGCCCTAAATAGAGAGCCCTGATTTCATTTCAGCAGTCATCCAAACCCCCAGCCTTCTGGGAAGAAGAAGC

AGGATGAGAATAGTGCTAAAGAAAGTGCATCGCTGCTGAGTTGGAAGAGGCAGGGCAAAGAAACTGGCACAAGGTGCAGGCTGCCTCTACTGCTGTTGCT

TATAGCAGGCGCTCTTTCTCTCTCCTTCCTTCTCCCAGAGACACAGTGCTACAGGCAGCTGGGTCTGTCTGCAAGCACACAGGATGAAGGGGTTGCCGCA

CTGTTTATATATGGTCCAATCTCTCACCATCTCTTGAGCAGCTGTTGGCCTATAATCAGCAGATTTCAGTCCAGTCCTCTCATGCAAAGAAACACACGCC

CCTCACGTTCTCTGCCGCTGAAGGCTTCCATCACTGCCATCACCTAGTAACCATAGCAACCCAACCTACTCTAAAACTAAGCCAAAAATAATACTTCTCT

TTGTATAACAACCTCCCCCCCCCCCCCAGCTCTGGCGAGTTTTTTTTTTTTTTTTTTTTTTTAATGGTCTTCCAACAATCTGAAGCAGAGGATTAGACCA

TTAGAGTAGTCTATTTGGGGCAGATAGCCCTTAGAATTTTTTGTTACTGAGGTCCTGGGATTTTAGAGATGATTCTTGGGCCAAACTTTGTAGCCTGATT

TTTAAAAGGACATCTATATCACTGCCACCCAGAACAAAAAGAGGGAATCATTAAATAGGATAGGCCATTAAGAATCTGTAGGACGCCAAATGTTGAGGCC

TGGAGGCTAGGCTGGGTACCTTCAAAGAGAGGGAATTCTCATTACAAGGACAAGCATCACATGACCTCAAAAGAACACAATCATGGTATCTTCGCACTCG

AATGTCCTTGATAGAGGGACTCTGGACAAACTGTCACACTTTCCAGGAGCCTCTCTGATGGCAACGTTGCACCAGAGAGTGTCTCAGGCTCCTGGAATTC

CCTTAGGGTTCTTTAATGAAGAGAAGAAAACTTGAATTGTGTTGAATTACTGTATCTTCTGCTTTTTTTTTTTAAAGATAAACTTGTAAATAGAATGATT

TG
Translation
TSSILATPRGWRVSSLKCCSTGNGEHVRELIATPAWAETWLCWSFSWIPGIEPPRAHVGRHICEPLVSSYLQALCPGKVLLPRPRCCNSQ HTIPEGKGF

VRLPS 
Transcript ENSMUST00000055428
Sequence
AGCCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAG - UNI36579 - GGATCAATGAGCAGGGGC

TCTACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGG ACCCCAAAGCAGCTTCTGAGACAGAAACTGATATCTGTGCCG

AATGGGAGATAAAGACCGTCACCAGTGCTCTGAAGACCTACCTGAG AATGCTCCCAGGACCCCTCATGATGTACCAGTTTCAAAGAAGTTTCATCAAAG

CAGCAA AGCTGGAAAACCAAGAGACTCGAGTGTCTGAGATCCACAGTCTTGTCCATCGGCTCCCGGAGAAGAATCGGCAGATGTTGCAGCTGCTCATGA

ACCACCTGGCCAA TGTTGCTAACAACCACAAGCAGAATCTGATGACTGTGGCAAACCTGGGCGTGGTGTTTGGACCCACCTTGCTTCGGCCTCAGGAAG

AAACTGTGGCGGCCATCATGGACATCAAGTTTCAGAACATTGTCATCGAGATCTTAATCGAGAACCATGAGAAG ATATTCAACACGGTGCCTGATGTGC

CCCTCACCAACGCCCAGCTACACCTGTCCCGGAAGAAAAGCAGTGACTCCAAGCCCCCATCCTGCAGCAAGAGGCCCCTGACGCTCTTCCATGCTGTGCC

ATCCACAGAAAAAC AGGAGCAGAGGAACAGCATCATCAACTCCAGTTTGGAATCGGTCTCCTCGAGTGCAAACAGCATCCTTAACTCTAGCAGCAGCCT

GCAGCCCAATCTGAATTCCAGCGACTCAAACCTGGATGTGGTCAAACCTAGTCGGCCCAGTTCACT CACACCATTCCGGAAGGCAAAGGCTTTGTACGC

CTGCCAAGCTGAGCACGACTCGGAGCTCTCCTTCACAGCGGGCACCGTCTTCGATAATG TTCATCCATCTCAGGAGCCTGGCTGGTTGGAGGGGACTCT

GAATGGAAAGACTGGCCTCATCCCAGAGAACTACGTGGAATTCCTCTAACCTTGAGCCCCAGTGGAGCTGCTGAGCTTCACGTGGTCTCCATGACAACTG

CTGCTTCTGGTGTTGTGGGCCACTTTTCATTGCCACTGAGAAAGCAGGGAGCCCGACTGTTGCTTCCTGCCAACACAAATGCATCTGGGAACGTGTGCCA

CCATTCTCCATGATCATCTCAGCTTACAGCACAGTAATGCTGCAAGAACTGCACAGCAATCAGCAGAGGAGGCCATTGGATTTTGATAACCCAGAGGAAG

GCTTGCAAAGCTGTCTTCTCACGAGTGCCCTAAATAGAGAGCCCTGATTTCATTTCAGCAGTCATCCAAACCCCCAGCCTTCTGGGAAGAAGAAGCAGGA

TGAGAATAGTGCTAAAGAAAGTGCATCGCTGCTGAGTTGGAAGAGGCAGGGCAAAGAAACTGGCACAAGGTGCAGGCTGCCTCTACTGCTGTTGCTTATA

GCAGGCGCTCTTTCTCTCTCCTTCCTTCTCCCAGAGACACAGTGCTACAGGCAGCTGGGTCTGTCTGCAAGCACACAGGATGAAGGGGTTGCCGCACTGT

TTATATATGGTCCAATCTCTCACCATCTCTTGAGCAGCTGTTGGCCTATAATCAGCAGATTTCAGTCCAGTCCTCTCATGCAAAGAAACACACGCCCCTC

ACGTTCTCTGCCGCTGAAGGCTTCCATCACTGCCATCACCTAGTAACCATAGCAACCCAACCTACTCTAAAACTAAGCCAAAAATAATACTTCTCTTTGT

ATAACAACCTCCCCCCCCCCCCCAGCTCTGGCGAGTTTTTTTTTTTTTTTTTTTTTTTAATGGTCTTCCAACAATCTGAAGCAGAGGATTAGACCATTAG

AGTAGTCTATTTGGGGCAGATAGCCCTTAGAATTTTTTGTTACTGAGGTCCTGGGATTTTAGAGATGATTCTTGGGCCAAACTTTGTAGCCTGATTTTTA

AAAGGACATCTATATCACTGCCACCCAGAACAAAAAGAGGGAATCATTAAATAGGATAGGCCATTAAGAATCTGTAGGACGCCAAATGTTGAGGCCTGGA

GGCTAGGCTGGGTACCTTCAAAGAGAGGGAATTCTCATTACAAGGACAAGCATCACATGACCTCAAAAGAACACAATCATGGTATCTTCGCACTCGAATG

TCCTTGATAGAGGGACTCTGGACAAACTGTCACACTTTCCAGGAGCCTCTCTGATGGCAACGTTGCACCAGAGAGTGTCTCAGGCTCCTGGAATTCCCTT

AGGGTTCTTTAATGAAGAGAAGAAAACTTGAATTGTGTTGAATTACTGTATCTTCTGCTTTTTTTTTTTAAAGATAAACTTGTAAATAGAATGATTTG
Translation
 - UNI36579 -     MDIKFQNIVIEILIENHEK IFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRPLTLFHAVPSTEKQ QEQRNSIINSSLES

VSSSANSILNSSSSLQPNLNSSDSNLDVVKPSRPSSL LTPFRKAKALYACQAEHDSELSFTAGTVFDNV VHPSQEPGWLEGTLNGKTGLIPENYVEFL

Transcript ENSMUST00000115574
Sequence
GCTTCTGTGAGAGGGCGCTCGAGGCTGCTTGAGGCTGCTGAGGAGCAAGCCCGCAGAGGAGGCGGGGAGGCGGTGGCCCGGCTGGTTCGCTTCCAGGCTC

CGCCAAGGGTCCGCCGCCGCGCTTTCTGCCGGTGTGCAGTTCGGTGGCTCTCCGCAGGAGCAGCCGCCGTCCGTCCGGGTCCCCGCTGCGGTCCTGAGTC

TCCTGCTCCCGCTGACCCCGCGCGCGGGGTAGCCGGCGCCACCCACACCTGTGGATCGGCCGTCGTCGCGGGTGTCCGCCGACCAGCGTGCGAGGCGCGT

CCCCTCAGCCCGGCTGGCTCCGCGGGCAGAAATGGGGCTCCCGGCGCTCGAGTTCAGCGACTGCTGCCTCGACAGCCCTCACTTCCGAGAGACGCTCAAG

TCACACGAAGCGGAGCTGGACAAGACCAACAAATTCATCAAGGAGCTCATCAAGGACGGGAAGTCGCTCATCAGCGCGCTCAAGA - UNI26126 - A

TTTGTCTTCGGCAAAGCGGAAGTTTGCAGATTCCTTAAATGAATTTAAATTTCAGTGTATAGGAGATGCCGAAACAGATGATGAGATGTGTATAG CGAG

ATCTTTGCAAGAATTTGCTGCTGTTCTCAGGAATCTTGAAGACGAGCGGAGTCGAATGGTGAGTGTCCTGGGCTGACCGCTGGGCTGCTCTTGCTCCCAG

ACAGTCTGGGTACACTGAGAGAACAAGGAATTTGCTGTCAGAAGACTCTGCCTCTGTGAACTTGCAGGCTGTGAGCCTTTGCAGAATTTGAAGCTCTCTG

TGACTGTTAAAGAATTACTAGTGCATAACTTTGGATGAGTATCATTGTCCTAAAAACTCACTGTATACCTGGGGATATTCACACATTATACCAAAAGATG

GAGGGATTTCTTTAAGGCCGGCAGAGGCCCTCCCTTTTGTGACTGCTTCCTGTGGTTTGCTTGAACTCAGATTGGTCTGGCAGTGGCAGTGGCAGTGGCA

GGTGTGGTGGTGGGTAGTTGGGGGTGAAGACTTGAGTGTGCACCTGCTAATGCCGAAGAAAGGGGAATGGACCTGCTGAGTCTGATTCTTGGCCCTGCCA

ATATTTGGGGCCAGGGTATAGTAAGCAAATTGCTGTGGCTTGTAATGGGAGAACAATGCTTGGATTCTACCTCT
Translation
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKN - UNI26126 - NLSSAKRKFADSLNEFKFQCIGDAETDDEMCIA 

ARSLQEFAAVLRNLEDERSRMVSVLG
Transcript ENSMUST00000077134
Sequence
GCTTCTGTGAGAGGGCGCTCGAGGCTGCTTGAGGCTGCTGAGGAGCAAGCCCGCAGAGGAGGCGGGGAGGCGGTGGCCCGGCTGGTTCGCTTCCAGGCTC

CGCCAAGGGTCCGCCGCCGCGCTTTCTGCCGGTGTGCAGTTCGGTGGCTCTCCGCAGGAGCAGCCGCCGTCCGTCCGGGTCCCCGCTGCGGTCCTGAGTC

TCCTGCTCCCGCTGACCCCGCGCGCGGGGTAGCCGGCGCCACCCACACCTGTGGATCGGCCGTCGTCGCGGGTGTCCGCCGACCAGCGTGCGAGGCGCGT

CCCCTCAGCCCGGCTGGCTCCGCGGGCAGAAATGGGGCTCCCGGCGCTCGAGTTCAGCGACTGCTGCCTCGACAGCCCTCACTTCCGAGAGACGCTCAAG

TCACACGAAGCGGAGCTGGACAAGACCAACAAATTCATCAAGGAGCTCATCAAGGACGGGAAGTCGCTCATCAGCGCGCTCAAGA - UNI26126 - A

TTTGTCTTCGGCAAAGCGGAAGTTTGCAGATTCCTTAAATGAATTTAAATTTCAGTGTATAGGAGATGCCGAAACAGATGATGAGATGTGTATAG CGAG

ATCTTTGCAAGAATTTGCTGCTGTTCTCAGGAATCTTGAAGACGAGCGGAGTCGAATG ATCGAGAATGCCAGCGAGGTGCTCATCACACCCTTGGAGAA

GTTTCGAAAGGAGCAGATTGGGGCCGCCAGG GAAGCCAAAAAGAAGTATGACAAAGAGACCGAGAAGTACTGCGGCACCTTAGAAAAACATTTGAATTT

GTCTTCCAAAAAGAAGGAATCCCAGCTACAGGAG GCAGACAGCCAAGTGGACCTGGTTCGGCAACATTTCTACGAAGTATCCCTGGAGTATGTCTTTAA

GGTGCAGGAAGTGCAAGAGAGAAAGATGTTTGAGTTTGTAGAGCCT CTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGAGCT

GGCCAAGGATTTTGGTGACTTTAAGACACAGTTGACCATCAGCATACAAAAT ACAAGAAACCGCTTTGAAGGAACCAGGTCTGAGGTGGAATCGCTGAT

GAAGAAGATGAAGGAAAACCCCCTGGAGCACAAGACCATCAGCCCGTACACCATGGAAGGGTACCTGTACGTGCAGGAGAAGC GTCACTTTGGAACTTC

CTGGGTGAAGCACTACTGTACCTACCAACGGGATTCCAAACAAATCACCATGGTTCCATTCGACCAAAAGTCAGGAGGAAAGGGG GGAGAAGACGAGTC

CGTTACCCTCAAATCCTGCACACGGCGAAAGACAGACTCCATCGAGAAGCGATTCTGCTTTGACGTGGAAGCAGTAGACAG GCCAGGGGTTATCACCAT

GCAGGCGTTGTCGGAAGAGGACCGTAGGCTCTGGATGGAAGCCATGGATGGCCGGGAACCT GTGTACAACTCCAACAGAGACAGCCAGAGCGAAGGGA 

CCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAG - UNI36579 - GGATCAATGAGCAGGGGCTC

TACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGG ACCCCAAAGCAGCTTCTGAGACAGAAACTGATATCTGTGCCGAA

TGGGAGATAAAGACCGTCACCAGTGCTCTGAAGACCTACCTGAG AATGCTCCCAGGACCCCTCATGATGTACCAGTTTCAAAGAAGTTTCATCAAAGCA

GCAA AGCTGGAAAACCAAGAGACTCGAGTGTCTGAGATCCACAGTCTTGTCCATCGGCTCCCGGAGAAGAATCGGCAGATGTTGCAGCTGCTCATGAAC

CACCTGGCCAA TGTTGCTAACAACCACAAGCAGAATCTGATGACTGTGGCAAACCTGGGCGTGGTGTTTGGACCCACCTTGCTTCGGCCTCAGGAAGAA

ACTGTGGCGGCCATCATGGACATCAAGTTTCAGAACATTGTCATCGAGATCTTAATCGAGAACCATGAGAAG ATATTCAACACGGTGCCTGATGTGCCC

CTCACCAACGCCCAGCTACACCTGTCCCGGAAGAAAAGCAGTGACTCCAAGCCCCCATCCTGCAGCAAGAGGCCCCTGACGCTCTTCCATGCTGTGCCAT

CCACAGAAAAAC AGGAGCAGAGGAACAGCATCATCAACTCCAGTTTGGAATCGGTCTCCTCGAGTGCAAACAGCATCCTTAACTCTAGCAGCAGCCTGC

AGCCCAATCTGAATTCCAGCGACTCAAACCTGGATGTGGTCAAACCTAGTCGGCCCAGTTCACT CCCCCCGAATCCAAGCCCAACTTCACCCCTCTCGC

CATCATGGCCCATGTTCTCGGCACCATCCAGCCCTATGCCCACCTCATCCACGTCCAGCGACTCATCCCCCATCAG GCCAGAAGAAGCGGTCCGTGAAG

ACTCCAG CACACCATTCCGGAAGGCAAAGGCTTTGTACGCCTGCCAAGCTGAGCACGACTCGGAGCTCTCCTTCACAGCGGGCACCGTCTTCGATAATG

 TTCATCCATCTCAGGAGCCTGGCTGGTTGGAGGGGACTCTGAATGGAAAGACTGGCCTCATCCCAGAGAACTACGTGGAATTCCTCTAACCTTGAGCCC

CAGTGGAGCTGCTGAGCTTCACGTGGTCTCCATGACAACTGCTGCTTCTGGTGTTGTGGGCCACTTTTCATTGCCACTGAGAAAGCAGGGAGCCCGACTG

TTGCTTCCTGCCAACACAAATGCATCTGGGAACGTGTGCCACCATTCTCCATGATCATCTCAGCTTACAGCACAGTAATGCTGCAAGAACTGCACAGCAA

TCAGCAGAGGAGGCCATTGGATTTTGATAACCCAGAGGAAGGCTTGCAAAGCTGTCTTCTCACGAGTGCCCTAAATAGAGAGCCCTGATTTCATTTCAGC

AGTCATCCAAACCCCCAGCCTTCTGGGAAGAAGAAGCAGGATGAGAATAGTGCTAAAGAAAGTGCATCGCTGCTGAGTTGGAAGAGGCAGGGCAAAGAAA

CTGGCACAAGGTGCAGGCTGCCTCTACTGCTGTTGCTTATAGCAGGCGCTCTTTCTCTCTCCTTCCTTCTCCCAGAGACACAGTGCTACAGGCAGCTGGG

TCTGTCTGCAAGCACACAGGATGAAGGGGTTGCCGCACTGTTTATATATGGTCCAATCTCTCACCATCTCTTGAGCAGCTGTTGGCCTATAATCAGCAGA

TTTCAGTCCAGTCCTCTCATGCAAAGAAACACACGCCCCTCACGTTCTCTGCCGCTGAAGGCTTCCATCACTGCCATCACCTAGTAACCATAGCAACCCA

ACCTACTCTAAAACTAAGCCAAAAATAATACTTCTCTTTGTATAACAACCTCCCCCCCCCCCCCAGCTCTGGCGAGTTTTTTTTTTTTTTTTTTTTTTTA

ATGGTCTTCCAACAATCTGAAGCAGAGGATTAGACCATTAGAGTAGTCTATTTGGGGCAGATAGCCCTTAGAATTTTTTGTTACTGAGGTCCTGGGATTT

TAGAGATGATTCTTGGGCCAAACTTTGTAGCCTGATTTTTAAAAGGACATCTATATCACTGCCACCCAGAACAAAAAGAGGGAATCATTAAATAGGATAG

GCCATTAAGAATCTGTAGGACGCCAAATGTTGAGGCCTGGAGGCTAGGCTGGGTACCTTCAAAGAGAGGGAATTCTCATTACAAGGACAAGCATCACATG

ACCTCAAAAGAACACAATCATGGTATCTTCGCACTCGAATGTCCTTGATAGAGGGACTCTGGACAAACTGTCACACTTTCCAGGAGCCTCTCTGATGGCA

ACGTTGCACCAGAGAGTGTCTCAGGCTCCTGGAATTCCCTTAGGGTTCTTTAATGAAGAGAAGAAAACTTGAATTGTGTTGAATTACTGTATCTTCTGCT

TTTTTTTTTTAAAGATAAACTTGTAAATAGAATGATTTGAAATATTATATGGTAAAGTTTTATATTTGATATTCTTTAAGCTAGTTTGCTCCATACATTT

AGTATTTTGATTGCTGAACAGATGTGTTTAAAAGGTTGCAAGAGAGGCCGGGCTAAAGAGTCAAGGTCATGTCCCCTCTCTGGCCCAGTGAAAGAATGTG

TCCTCAATGGTTCCTGTTGGTGAGCCTGGAAAGTTGGTTGCATTCAGTTGTCTTTATCTACATGTGATTTGGGGCTTTGGAGTTCAAAAGAGCATCTTCA

AGCAGTGAATTTTCAAAGAACTCCCACCCAACAGTAAAGTGACACTCAGGATCTCAGGATTTAAATAGGTGGGGTGAGGGCGACATGTTTGTTTTTTGTT

TGTGTGTTTGTTCTTCTCAGGTGTATTTCTTGGTACCCCAGGATGTCCAGACAAAAGGAGATGAGCCAACACTCCTTTTTCCCCCACATCTCCAAGCTAG

TTTATAAATGTGTCTATCAACTCTAAGAACTAAACAAGAAAGCCAGCTGCTGTGGTTCTTGGTCATTGGTGAACTTTACTCTCTTCCTATAGACGTGTTC

CCGCACTTCCCCTTCACCTCCAAAGTCCCGGCAGCCCCAAAGTAAAAAAGAATCCCCAAGATGACACTGTTACAGTTTTTAGAGGTGCTGTAATGTTAAT

AGTTCATTGTCGGGATTCAGTATTGAGTTTACCAGCTCAGGATTATACTGTTGCCAACCAAGGACCCAGCCAGGAGCAAGGGAGACTTGAACTTTCAGTC

AGGCAAACACAGGATTCCAAACTGACAATGCTGGGTGTGATGGCTCATGTGTGGTCTTAGCACTTGGAAGACAGAGACAAGAGGATTGCTGAAGACTTAC

GCCAGCCAGATGTGAGGCTGGAGGAGGGTTGCAAACGGAAGGAAGAAAGGCAGTACACTCAGGTTCCAGACCTATTCCCTGTGAGCTTGAGAAAAGGTTG

GGCAATGGGGCCCGAAGGGCATGCACACTCAAGTAGCATTGCTCCTTCCAAATTAAAAGAGCCCAGCATGATACTTTTAATATATCTGATGGTTTAAATT

GTCGCCTGCCCCATAATAAATGAACTATGCTTGTAGTCAGGGCCCAGCACGACTGCTTGGATACATATTCTTTCTCTCCTGAGCTGGCCCTGGTTTGAAA

CTGCTCTCTTAGGCTGACCTCCTTCCAGTTTCCCTGAGGCCATGTGTGGCCTATGACAGATGGTCGCTCTGTTTCCCTTTGTCCAGCTAGGCCTCCCTCC

TATTCCTCCTCCTCGTCCTCCTCAGGAAAAAGAACTGGAGAGATTAATATGAGCCAAGTAGGAAGGAACTTGAAGATTAAAAGTGTTATGTGCCCTTTCT

GCTCTCTGAACACCCCTGAGCTCCCCACAAATAAGGAAAACTGGGGTAGATCATGAGGAATGAGTTGATATCAGAATGGAAGTTCATTGACCAGAGTCCC

AAAGATTTCCCAGGAGCTTTGAGTTTCTCTTGTAAGACCCTGGGATGGGTTGGTTATGGTTTGAATTTTGGAGCATCAAGATGGTTGGTCTTACTCTCTG

AGATAGAGAGTTCCATAATTGAACAGTGCCATTCTGTGCTATGAAATGAGAAGATAGCTGCTTTCACATCTCTGCCCCCAAGCAAGGAAAATGAGCTTGT

TCAACACTGATGAAATTCTCTATTTTTTCTTTTTTTAAAATAAATGTGTGTGACTGACCTCCATTCAGTGGATGCCTCAGTCTTTAGTATTAGAGCCAGT

TTGTAGTATTTTTAAAGCCATTATGTGAAGTCTTGTGGATGCTTTTTTTAATTTTTTTTTTAAATCAGAGAAGAAATGAGAAGAGAGTACTTCCAACTGG

GCACTGGTGAGCCAGAGCCATGCTGGCTGGTTGGGAGTTACAGGCGCTCTAGACCTGAGTGTGCCACATCTGGATCTTAAGGGAAATCCTTCTTAACTGC

ATTCCCCCCCAACCCCCCCAGGACAGTAGCAATCACACCAAAAGCTGCTTCAGTCATAGAACTTCCAGAAGCATCCATTATTGAGGCAGGGGGAAGTAGA

CTAAAGAGGGTGAGATCATCTGTTCTTGGCCGGCTATATCTGCTTCCTGTGACAAGGCTGTTTACCTAGCTTCATAGCCAGCGAGCTTGGGGGTGCACCA

GTGACCACACATTTGCCCTGGCACCCACTGTTCTTAGTAGACAAGGGAACCAAGCGTCTGCTTAGCTACCTGTCTTTCAAAGGAATGTTCTGGCTGTCTA

GGAAGGGAGTTGTCTGCCAATTCTGTCAAACTTGACAGTGATCACTTACGTTGATAGCCCTGTCCCAACAGCCCTTTAATCAGTCAGGTGCCCCTCACTC

CCCATAGTAGTGCATGAAAAAATATCTTTTGCATTCAAATATTTCTGCACCCATGCAGATCTAGTGTTTGTCTGTGAATGTAGTATCAAAATGACAACAG

CAGAGAGCTGGGACTGAACCTTGGACATGCCTCCAACATGCTGAGACAAGACTCCACCAGGCGATGACGGGCCTTCTTCCCTTTGCCGCCCACAGCACGT

GTCTAACTTAAAGAGCCACCCTAAGTAGACAGAGATTCCAGACGTCACTCGGAGGCAGCCCTGTACTCATGGAAGGAAAGCATAGATATAAAAACACCCG

GATCAGGAAGGAAAGGTGAGCCACCCTGAGAGCAAGAACTAAGCATAGTCCTAACCCACAGAGGGAGGGCCAAGAACTATCCTGTCAAAATTCACATTAG

TGCAGTCAGTGGGGAGCAAGGTTGTGGTAACTCAGTGTCTGAGTGACCTGGAGTAGCTTCAGGCAGGCTGGCATACTCTCTGCCATCATGCACTCACACA

TGCATACCTACCATTCTTGCGGCTTCTGAGTAAACACCAACAAACAGCATCCCCGGGGTTCAAGATGCCCGAGTCAGCTTGGTGTCTGTGAAAGCATACA

TGTGGGGATTCTAAAATTTGTGTGTGCGTGTGTTGGTGTGTATGTGTTCGTACATAGCACATACAAGCATAAAGGTGCCGCCTCGGGTGTAGACACACAC

ACACAAGCTGGCATTTGTAAAGCTCTTACAGCCTTGAAGATTTGGAGGGAAGAGTTTTCAGAGGAACTAGAGTCTGTCAGTTTCCTAGCAAAAGATCAAA

GCTACAAACGAGCTGTCATCTGAAGCCTCTGTTCGTGTTTATCACATAGTTATCCACAGCTGCGTTCCTTGGTGACTTATTAAAAGTCAGGTTAAAAACT

CAAACCCATAAATTTCCAGTAGCTAATGCTAGGCTAGTGTTCAAAAGCACTCTAAAAGACATTTAGTCCATATTTTGGGAAAGAAACTATTTGCATGTTT

AATTCATCTTTTAGGCTGCTGTTGAGTATACTGTAAAGTGCTGTGTGATATCAAGCCAGTAAAGTACTTATAAATGGCACTTTAATATTTTCTTTTGAGA

AATCATAAAACACTGTTGTAAATTTCACTATTGAATATTGACTGGTACATAGAATCAAACTCTGTAATTAAAAAGTAGCCTGCAGCTAGGATAGAACATT

TTTCTTGTTATTAGAGAAAAAAAAAAAGTTTGCCATGTTCAGGCTTTTTAAAAAAAAAGTGTTTCTGTGCCATTGTTCGTATCTATAAAGAAAATACAAT

TTCTGTCAGGCATCTCTGAAACCTGGCTTTTTTTATGTTTGGTTCGTGTCTGTGGCAATCCCTATAAAGTGAGTGGAAGTATGATTTTTGAATTAAATGA

CTTTCCCATTTGA
Translation
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKN - UNI26126 - NLSSAKRKFADSLNEFKFQCIGDAETDDEMCIA 

ARSLQEFAAVLRNLEDERSRM IENASEVLITPLEKFRKEQIGAAR EAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQE ADSQVDLVRQHFYEVSLE

YVFKVQEVQERKMFEFVEP LLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQN TRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKR

 RHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKG GEDESVTLKSCTRRKTDSIEKRFCFDVEAVDR RPGVITMQALSEEDRRLWMEAMDGREP VYN

SNRDSQSEGT TAQLDSIGFSIIRKCIHAVETRG - UNI36579 - GINEQGLYRIVGVNSRVQKLLSVLMD DPKAASETETDICAEWEIKTVTSAL

KTYLR RMLPGPLMMYQFQRSFIKAAK KLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLAN NVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAI

MDIKFQNIVIEILIENHEK IFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRPLTLFHAVPSTEKQ QEQRNSIINSSLESVSSSANSILNSSSSLQPN

LNSSDSNLDVVKPSRPSSL LPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIR RPEEAVREDSS STPFRKAKALYACQAEHDSELSFTAGTVF

DNV VHPSQEPGWLEGTLNGKTGLIPENYVEFL
Transcript ENSMUST00000097593
Sequence
GCTTCTGTGAGAGGGCGCTCGAGGCTGCTTGAGGCTGCTGAGGAGCAAGCCCGCAGAGGAGGCGGGGAGGCGGTGGCCCGGCTGGTTCGCTTCCAGGCTC

CGCCAAGGGTCCGCCGCCGCGCTTTCTGCCGGTGTGCAGTTCGGTGGCTCTCCGCAGGAGCAGCCGCCGTCCGTCCGGGTCCCCGCTGCGGTCCTGAGTC

TCCTGCTCCCGCTGACCCCGCGCGCGGGGTAGCCGGCGCCACCCACACCTGTGGATCGGCCGTCGTCGCGGGTGTCCGCCGACCAGCGTGCGAGGCGCGT

CCCCTCAGCCCGGCTGGCTCCGCGGGCAGAAATGGGGCTCCCGGCGCTCGAGTTCAGCGACTGCTGCCTCGACAGCCCTCACTTCCGAGAGACGCTCAAG

TCACACGAAGCGGAGCTGGACAAGACCAACAAATTCATCAAGGAGCTCATCAAGGACGGGAAGTCGCTCATCAGCGCGCTCAAGA - UNI26126 - A

TTTGTCTTCGGCAAAGCGGAAGTTTGCAGATTCCTTAAATGAATTTAAATTTCAGTGTATAGGAGATGCCGAAACAGATGATGAGATGTGTATAG CGAG

ATCTTTGCAAGAATTTGCTGCTGTTCTCAGGAATCTTGAAGACGAGCGGAGTCGAATG ATCGAGAATGCCAGCGAGGTGCTCATCACACCCTTGGAGAA

GTTTCGAAAGGAGCAGATTGGGGCCGCCAGG GAAGCCAAAAAGAAGTATGACAAAGAGACCGAGAAGTACTGCGGCACCTTAGAAAAACATTTGAATTT

GTCTTCCAAAAAGAAGGAATCCCAGCTACAGGAG GCAGACAGCCAAGTGGACCTGGTTCGGCAACATTTCTACGAAGTATCCCTGGAGTATGTCTTTAA

GGTGCAGGAAGTGCAAGAGAGAAAGATGTTTGAGTTTGTAGAGCCT CTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGAGCT

GGCCAAGGATTTTGGTGACTTTAAGACACAGTTGACCATCAGCATACAAAAT ACAAGAAACCGCTTTGAAGGAACCAGGTCTGAGGTGGAATCGCTGAT

GAAGAAGATGAAGGAAAACCCCCTGGAGCACAAGACCATCAGCCCGTACACCATGGAAGGGTACCTGTACGTGCAGGAGAAGC GTCACTTTGGAACTTC

CTGGGTGAAGCACTACTGTACCTACCAACGGGATTCCAAACAAATCACCATGGTTCCATTCGACCAAAAGTCAGGAGGAAAGGGG GGAGAAGACGAGTC

CGTTACCCTCAAATCCTGCACACGGCGAAAGACAGACTCCATCGAGAAGCGATTCTGCTTTGACGTGGAAGCAGTAGACAG GCCAGGGGTTATCACCAT

GCAGGCGTTGTCGGAAGAGGACCGTAGGCTCTGGATGGAAGCCATGGATGGCCGGGAACCT GTGTACAACTCCAACAGAGACAGCCAGAGCGAAGGGA 

CCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAG - UNI36579 - GGATCAATGAGCAGGGGCTC

TACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGG ACCCCAAAGCAGCTTCTGAGACAGAAACTGATATCTGTGCCGAA

TGGGAGATAAAGACCGTCACCAGTGCTCTGAAGACCTACCTGAG AATGCTCCCAGGACCCCTCATGATGTACCAGTTTCAAAGAAGTTTCATCAAAGCA

GCAA AGCTGGAAAACCAAGAGACTCGAGTGTCTGAGATCCACAGTCTTGTCCATCGGCTCCCGGAGAAGAATCGGCAGATGTTGCAGCTGCTCATGAAC

CACCTGGCCAA TGTTGCTAACAACCACAAGCAGAATCTGATGACTGTGGCAAACCTGGGCGTGGTGTTTGGACCCACCTTGCTTCGGCCTCAGGAAGAA

ACTGTGGCGGCCATCATGGACATCAAGTTTCAGAACATTGTCATCGAGATCTTAATCGAGAACCATGAGAAG ATATTCAACACGGTGCCTGATGTGCCC

CTCACCAACGCCCAGCTACACCTGTCCCGGAAGAAAAGCAGTGACTCCAAGCCCCCATCCTGCAGCAAGAGGCCCCTGACGCTCTTCCATGCTGTGCCAT

CCACAGAAAAAC AGGAGCAGAGGAACAGCATCATCAACTCCAGTTTGGAATCGGTCTCCTCGAGTGCAAACAGCATCCTTAACTCTAGCAGCAGCCTGC

AGCCCAATCTGAATTCCAGCGACTCAAACCTGGATGTGGTCAAACCTAGTCGGCCCAGTTCACT CCCCCCGAATCCAAGCCCAACTTCACCCCTCTCGC

CATCATGGCCCATGTTCTCGGCACCATCCAGCCCTATGCCCACCTCATCCACGTCCAGCGACTCATCCCCCATCAGGTCTGTGGCAGGGTTTGTTTGGTT

TTCTGTTGCTGCCGTTGTTCTCTCATTGGCTTGGTCCTCTCTTCATGCAGTGTTCAGCCTCCTCGTCAACTTTGTTCCCTGCCATCCAAACCTGCACTTG

CTTTTTGACAGGCCAGAAGAAGCGGTCCGTGAAGACTCCAG CACACCATTCCGGAAGGCAAAGGCTTTGTACGCCTGCCAAGCTGAGCACGACTCGGAG

CTCTCCTTCACAGCGGGCACCGTCTTCGATAATG TTCATCCATCTCAGGAGCCTGGCTGGTTGGAGGGGACTCTGAATGGAAAGACTGGCCTCATCCCA

GAGAACTACGTGGAATTCCTCTAACCTTGAGCCCCAGTGGAGCTGCTGAGCTTCACGTGGTCTCCATGACAACTGCTGCTTCTGGTGTTGTGGGCCACTT

TTCATTGCCACTGAGAAAGCAGGGAGCCCGACTGTTGCTTCCTGCCAACACAAATGCATCTGGGAACGTGTGCCACCATTCTCCATGATCATCTCAGCTT

ACAGCACAGTAATGCTGCAAGAACTGCACAGCAATCAGCAGAGGAGGCCATTGGATTTTGATAACCCAGAGGAAGGCTTGCAAAGCTGTCTTCTCACGAG

TGCCCTAAATAGAGAGCCCTGATTTCATTTCAGCAGTCATCCAAACCCCCAGCCTTCTGGGAAGAAGAAGCAGGATGAGAATAGTGCTAAAGAAAGTGCA

TCGCTGCTGAGTTGGAAGAGGCAGGGCAAAGAAACTGGCACAAGGTGCAGGCTGCCTCTACTGCTGTTGCTTATAGCAGGCGCTCTTTCTCTCTCCTTCC

TTCTCCCAGAGACACAGTGCTACAGGCAGCTGGGTCTGTCTGCAAGCACACAGGATGAAGGGGTTGCCGCACTGTTTATATATGGTCCAATCTCTCACCA

TCTCTTGAGCAGCTGTTGGCCTATAATCAGCAGATTTCAGTCCAGTCCTCTCATGCAAAGAAACACACGCCCCTCACGTTCTCTGCCGCTGAAGGCTTCC

ATCACTGCCATCACCTAGTAACCATAGCAACCCAACCTACTCTAAAACTAAGCCAAAAATAATACTTCTCTTTGTATAACAACCTCCCCCCCCCCCCCAG

CTCTGGCGAGTTTTTTTTTTTTTTTTTTTTTTTAATGGTCTTCCAACAATCTGAAGCAGAGGATTAGACCATTAGAGTAGTCTATTTGGGGCAGATAGCC

CTTAGAATTTTTTGTTACTGAGGTCCTGGGATTTTAGAGATGATTCTTGGGCCAAACTTTGTAGCCTGATTTTTAAAAGGACATCTATATCACTGCCACC

CAGAACAAAAAGAGGGAATCATTAAATAGGATAGGCCATTAAGAATCTGTAGGACGCCAAATGTTGAGGCCTGGAGGCTAGGCTGGGTACCTTCAAAGAG

AGGGAATTCTCATTACAAGGACAAGCATCACATGACCTCAAAAGAACACAATCATGGTATCTTCGCACTCGAATGTCCTTGATAGAGGGACTCTGGACAA

ACTGTCACACTTTCCAGGAGCCTCTCTGATGGCAACGTTGCACCAGAGAGTGTCTCAGGCTCCTGGAATTCCCTTAGGGTTCTTTAATGAAGAGAAGAAA

ACTTGAATTGTGTTGAATTACTGTATCTTCTGCTTTTTTTTTTTAAAGATAAACTTGTAAATAGAATGATTTGAAATATTATATGGTAAAGTTTTATATT

TGATATTCTTTAAGCTAGTTTGCTCCATACATTTAGTATTTTGATTGCTGAACAGATGTGTTTAAAAGGTTGCAAGAGAGGCCGGGCTAAAGAGTCAAGG

TCATGTCCCCTCTCTGGCCCAGTGAAAGAATGTGTCCTCAATGGTTCCTGTTGGTGAGCCTGGAAAGTTGGTTGCATTCAGTTGTCTTTATCTACATGTG

ATTTGGGGCTTTGGAGTTCAAAAGAGCATCTTCAAGCAGTGAATTTTCAAAGAACTCCCACCCAACAGTAAAGTGACACTCAGGATCTCAGGATTTAAAT

AGGTGGGGTGAGGGCGACATGTTTGTTTTTTGTTTGTGTGTTTGTTCTTCTCAGGTGTATTTCTTGGTACCCCAGGATGTCCAGACAAAAGGAGATGAGC

CAACACTCCTTTTTCCCCCACATCTCCAAGCTAGTTTATAAATGTGTCTATCAACTCTAAGAACTAAACAAGAAAGCCAGCTGCTGTGGTTCTTGGTCAT

TGGTGAACTTTACTCTCTTCCTATAGACGTGTTCCCGCACTTCCCCTTCACCTCCAAAGTCCCGGCAGCCCCAAAGTAAAAAAGAATCCCCAAGATGACA

CTGTTACAGTTTTTAGAGGTGCTGTAATGTTAATAGTTCATTGTCGGGATTCAGTATTGAGTTTACCAGCTCAGGATTATACTGTTGCCAACCAAGGACC

CAGCCAGGAGCAAGGGAGACTTGAACTTTCAGTCAGGCAAACACAGGATTCCAAACTGACAATGCTGGGTGTGATGGCTCATGTGTGGTCTTAGCACTTG

GAAGACAGAGACAAGAGGATTGCTGAAGACTTACGCCAGCCAGATGTGAGGCTGGAGGAGGGTTGCAAACGGAAGGAAGAAAGGCAGTACACTCAGGTTC

CAGACCTATTCCCTGTGAGCTTGAGAAAAGGTTGGGCAATGGGGCCCGAAGGGCATGCACACTCAAGTAGCATTGCTCCTTCCAAATTAAAAGAGCCCAG

CATGATACTTTTAATATATCTGATGGTTTAAATTGTCGCCTGCCCCATAATAAATGAACTATGCTTGTAGTCAGGGCCCAGCACGACTGCTTGGATACAT

ATTCTTTCTCTCCTGAGCTGGCCCTGGTTTGAAACTGCTCTCTTAGGCTGACCTCCTTCCAGTTTCCCTGAGGCCATGTGTGGCCTATGACAGATGGTCG

CTCTGTTTCCCTTTGTCCAGCTAGGCCTCCCTCCTATTCCTCCTCCTCGTCCTCCTCAGGAAAAAGAACTGGAGAGATTAATATGAGCCAAGTAGGAAGG

AACTTGAAGATTAAAAGTGTTATGTGCCCTTTCTGCTCTCTGAACACCCCTGAGCTCCCCACAAATAAGGAAAACTGGGGTAGATCATGAGGAATGAGTT

GATATCAGAATGGAAGTTCATTGACCAGAGTCCCAAAGATTTCCCAGGAGCTTTGAGTTTCTCTTGTAAGACCCTGGGATGGGTTGGTTATGGTTTGAAT

TTTGGAGCATCAAGATGGTTGGTCTTACTCTCTGAGATAGAGAGTTCCATAATTGAACAGTGCCATTCTGTGCTATGAAATGAGAAGATAGCTGCTTTCA

CATCTCTGCCCCCAAGCAAGGAAAATGAGCTTGTTCAACACTGATGAAATTCTCTATTTTTTCTTTTTTTAAAATAAATGTGTGTGACTGACCTCCATTC

AGTGGATGCCTCAGTCTTTAGTATTAGAGCCAGTTTGTAGTATTTTTAAAGCCATTATGTGAAGTCTTGTGGATGCTTTTTTTAATTTTTTTTTTAAATC

AGAGAAGAAATGAGAAGAGAGTACTTCCAACTGGGCACTGGTGAGCCAGAGCCATGCTGGCTGGTTGGGAGTTACAGGCGCTCTAGACCTGAGTGTGCCA

CATCTGGATCTTAAGGGAAATCCTTCTTAACTGCATTCCCCCCCAACCCCCCCAGGACAGTAGCAATCACACCAAAAGCTGCTTCAGTCATAGAACTTCC

AGAAGCATCCATTATTGAGGCAGGGGGAAGTAGACTAAAGAGGGTGAGATCATCTGTTCTTGGCCGGCTATATCTGCTTCCTGTGACAAGGCTGTTTACC

TAGCTTCATAGCCAGCGAGCTTGGGGGTGCACCAGTGACCACACATTTGCCCTGGCACCCACTGTTCTTAGTAGACAAGGGAACCAAGCGTCTGCTTAGC

TACCTGTCTTTCAAAGGAATGTTCTGGCTGTCTAGGAAGGGAGTTGTCTGCCAATTCTGTCAAACTTGACAGTGATCACTTACGTTGATAGCCCTGTCCC

AACAGCCCTTTAATCAGTCAGGTGCCCCTCACTCCCCATAGTAGTGCATGAAAAAATATCTTTTGCATTCAAATATTTCTGCACCCATGCAGATCTAGTG

TTTGTCTGTGAATGTAGTATCAAAATGACAACAGCAGAGAGCTGGGACTGAACCTTGGACATGCCTCCAACATGCTGAGACAAGACTCCACCAGGCGATG

ACGGGCCTTCTTCCCTTTGCCGCCCACAGCACGTGTCTAACTTAAAGAGCCACCCTAAGTAGACAGAGATTCCAGACGTCACTCGGAGGCAGCCCTGTAC

TCATGGAAGGAAAGCATAGATATAAAAACACCCGGATCAGGAAGGAAAGGTGAGCCACCCTGAGAGCAAGAACTAAGCATAGTCCTAACCCACAGAGGGA

GGGCCAAGAACTATCCTGTCAAAATTCACATTAGTGCAGTCAGTGGGGAGCAAGGTTGTGGTAACTCAGTGTCTGAGTGACCTGGAGTAGCTTCAGGCAG

GCTGGCATACTCTCTGCCATCATGCACTCACACATGCATACCTACCATTCTTGCGGCTTCTGAGTAAACACCAACAAACAGCATCCCCGGGGTTCAAGAT

GCCCGAGTCAGCTTGGTGTCTGTGAAAGCATACATGTGGGGATTCTAAAATTTGTGTGTGCGTGTGTTGGTGTGTATGTGTTCGTACATAGCACATACAA

GCATAAAGGTGCCGCCTCGGGTGTAGACACACACACACAAGCTGGCATTTGTAAAGCTCTTACAGCCTTGAAGATTTGGAGGGAAGAGTTTTCAGAGGAA

CTAGAGTCTGTCAGTTTCCTAGCAAAAGATCAAAGCTACAAACGAGCTGTCATCTGAAGCCTCTGTTCGTGTTTATCACATAGTTATCCACAGCTGCGTT

CCTTGGTGACTTATTAAAAGTCAGGTTAAAAACTCAAACCCATAAATTTCCAGTAGCTAATGCTAGGCTAGTGTTCAAAAGCACTCTAAAAGACATTTAG

TCCATATTTTGGGAAAGAAACTATTTGCATGTTTAATTCATCTTTTAGGCTGCTGTTGAGTATACTGTAAAGTGCTGTGTGATATCAAGCCAGTAAAGTA

CTTATAAATGGCACTTTAATATTTTCTTTTGAGAAATCATAAAACACTGTTGTAAATTTCACTATTGAATATTGACTGGTACATAGAATCAAACTCTGTA

ATTAAAAAGTAGCCTGCAGCTAGGATAGAACATTTTTCTTGTTATTAGAGAAAAAAAAAAAGTTTGCCATGTTCAGGCTTTTTAAAAAAAAAGTGTTTCT

GTGCCATTGTTCGTATCTATAAAGAAAATACAATTTCTGTCAGGCATCTCTGAAACCTGGCTTTTTTTATGTTTGGTTCGTGTCTGTGGCAATCCCTATA

AAGTGAGTGGAAGTATGATTTTTGAATTAAATGACTTTCCCATTTGA
Translation
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKN - UNI26126 - NLSSAKRKFADSLNEFKFQCIGDAETDDEMCIA 

ARSLQEFAAVLRNLEDERSRM IENASEVLITPLEKFRKEQIGAAR EAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQE ADSQVDLVRQHFYEVSLE

YVFKVQEVQERKMFEFVEP LLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQN TRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKR

 RHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKG GEDESVTLKSCTRRKTDSIEKRFCFDVEAVDR RPGVITMQALSEEDRRLWMEAMDGREP VYN

SNRDSQSEGT TAQLDSIGFSIIRKCIHAVETRG - UNI36579 - GINEQGLYRIVGVNSRVQKLLSVLMD DPKAASETETDICAEWEIKTVTSAL

KTYLR RMLPGPLMMYQFQRSFIKAAK KLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLAN NVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAI

MDIKFQNIVIEILIENHEK IFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRPLTLFHAVPSTEKQ QEQRNSIINSSLESVSSSANSILNSSSSLQPN

LNSSDSNLDVVKPSRPSSL LPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVVLSLAWSSLHAVFSLLVNFVPCHPNLHLL

FDRPEEAVREDSS STPFRKAKALYACQAEHDSELSFTAGTVFDNV VHPSQEPGWLEGTLNGKTGLIPENYVEFL
Transcript ENSMUST00000115575
Sequence
GCTTCTGTGAGAGGGCGCTCGAGGCTGCTTGAGGCTGCTGAGGAGCAAGCCCGCAGAGGAGGCGGGGAGGCGGTGGCCCGGCTGGTTCGCTTCCAGGCTC

CGCCAAGGGTCCGCCGCCGCGCTTTCTGCCGGTGTGCAGTTCGGTGGCTCTCCGCAGGAGCAGCCGCCGTCCGTCCGGGTCCCCGCTGCGGTCCTGAGTC

TCCTGCTCCCGCTGACCCCGCGCGCGGGGTAGCCGGCGCCACCCACACCTGTGGATCGGCCGTCGTCGCGGGTGTCCGCCGACCAGCGTGCGAGGCGCGT

CCCCTCAGCCCGGCTGGCTCCGCGGGCAGAAATGGGGCTCCCGGCGCTCGAGTTCAGCGACTGCTGCCTCGACAGCCCTCACTTCCGAGAGACGCTCAAG

TCACACGAAGCGGAGCTGGACAAGACCAACAAATTCATCAAGGAGCTCATCAAGGACGGGAAGTCGCTCATCAGCGCGCTCAAGA - UNI26126 - A

TTTGTCTTCGGCAAAGCGGAAGTTTGCAGATTCCTTAAATGAATTTAAATTTCAGTGTATAGGAGATGCCGAAACAGATGATGAGATGTGTATAG CGAG

ATCTTTGCAAGAATTTGCTGCTGTTCTCAGGAATCTTGAAGACGAGCGGAGTCGAATG ATCGAGAATGCCAGCGAGGTGCTCATCACACCCTTGGAGAA

GTTTCGAAAGGAGCAGATTGGGGCCGCCAGG GAAGCCAAAAAGAAGTATGACAAAGAGACCGAGAAGTACTGCGGCACCTTAGAAAAACATTTGAATTT

GTCTTCCAAAAAGAAGGAATCCCAGCTACAGGAG GCAGACAGCCAAGTGGACCTGGTTCGGCAACATTTCTACGAAGTATCCCTGGAGTATGTCTTTAA

GGTGCAGGAAGTGCAAGAGAGAAAGATGTTTGAGTTTGTAGAGCCT CTGCTGGCCTTCCTGCAAGGACTCTTCACTTTCTATCACCATGGTTATGAGCT

GGCCAAGGATTTTGGTGACTTTAAGACACAGTTGACCATCAGCATACAAAAT ACAAGAAACCGCTTTGAAGGAACCAGGTCTGAGGTGGAATCGCTGAT

GAAGAAGATGAAGGAAAACCCCCTGGAGCACAAGACCATCAGCCCGTACACCATGGAAGGGTACCTGTACGTGCAGGAGAAGC GTCACTTTGGAACTTC

CTGGGTGAAGCACTACTGTACCTACCAACGGGATTCCAAACAAATCACCATGGTTCCATTCGACCAAAAGTCAGGAGGAAAGGGG GGAGAAGACGAGTC

CGTTACCCTCAAATCCTGCACACGGCGAAAGACAGACTCCATCGAGAAGCGATTCTGCTTTGACGTGGAAGCAGTAGACAG GCCAGGGGTTATCACCAT

GCAGGCGTTGTCGGAAGAGGACCGTAGGCTCTGGATGGAAGCCATGGATGGCCGGGAACCT GTGTACAACTCCAACAGAGACAGCCAGAGCGAAGGGA 

CCGCACAATTGGACAGTATCGGCTTCAGCATAATAAGGAAATGCATCCATGCGGTGGAGACCAGAG - UNI36579 - GGATCAATGAGCAGGGGCTC

TACCGAATCGTGGGGGTCAACTCCAGGGTGCAGAAGTTGCTGAGCGTCCTGATGG ACCCCAAAGCAGCTTCTGAGACAGAAACTGATATCTGTGCCGAA

TGGGAGATAAAGACCGTCACCAGTGCTCTGAAGACCTACCTGAG AATGCTCCCAGGACCCCTCATGATGTACCAGTTTCAAAGAAGTTTCATCAAAGCA

GCAA AGCTGGAAAACCAAGAGACTCGAGTGTCTGAGATCCACAGTCTTGTCCATCGGCTCCCGGAGAAGAATCGGCAGATGTTGCAGCTGCTCATGAAC

CACCTGGCCAA TGTTGCTAACAACCACAAGCAGAATCTGATGACTGTGGCAAACCTGGGCGTGGTGTTTGGACCCACCTTGCTTCGGCCTCAGGAAGAA

ACTGTGGCGGCCATCATGGACATCAAGTTTCAGAACATTGTCATCGAGATCTTAATCGAGAACCATGAGAAG ATATTCAACACGGTGCCTGATGTGCCC

CTCACCAACGCCCAGCTACACCTGTCCCGGAAGAAAAGCAGTGACTCCAAGCCCCCATCCTGCAGCAAGAGGCCCCTGACGCTCTTCCATGCTGTGCCAT

CCACAGAAAAAC AGGAGCAGAGGAACAGCATCATCAACTCCAGTTTGGAATCGGTCTCCTCGAGTGCAAACAGCATCCTTAACTCTAGCAGCAGCCTGC

AGCCCAATCTGAATTCCAGCGACTCAAACCTGGATGTGGTCAAACCTAGTCGGCCCAGTTCACT CCCCCCGAATCCAAGCCCAACTTCACCCCTCTCGC

CATCATGGCCCATGTTCTCGGCACCATCCAGCCCTATGCCCACCTCATCCACGTCCAGCGACTCATCCCCCATCAGGTCTGTGGCAGGGTTTGTTTGGTT

TTCTGTTGCTGCCGTTGTTCTCTCATTGGCTTGGTCCTCTCTTCATGCAGTGTTCAGCCTCCTCGTCAACTTTGTTCCCTGCCATCCAAACCTGCACTTG

CTTTTTGACAGGCCAGAAGAAGCGGTCCGTGAAGACTCCAG CACACCATTCCGGAAGGCAAAGGCTTTGTACGCCTGCCAAGCTGAGCACGACTCGGAG

CTCTCCTTCACAGCGGGCACCGTCTTCGATAATG TTCATCCATCTCAGGAGCCTGGCTGGTTGGAGGGGACTCTGAATGGAAAGACTGGCCTCATCCCA

GAGAACTACGTGGAATTCCTCTAACCTTGAGCCCCAGTGGAGCTGCTGAGCTTCACGTGGTCTCCATGACAACTGCTGCTTCTGGTGTTGTGGGCCACTT

TTCATTGCCACTGAGAAAGCAGGGAGCCCGACTGTTGCTTCCTGCCAACACAAATGCATCTGGGAACGTGTGCCACCATTCTCCATGATCATCTCAGCTT

ACAGCACAGTAATGCTGCAAGAACTGCACAGCAATCAGCAGAGGAGGCCATTGGATTTTGATAACCCAGAGGAAGGCTTGCAAAGCTGTCTTCTCACGAG

TGCCCTAAATAGAGAGCCCTGATTTCATTTCAGCAGTCATCCAAACCCCCAGCCTTCTGGGAAGAAGAAGCAGGATGAGAATAGTGCTAAAGAAAGTGCA

TCGCTGCTGAGTTGGAAGAGGCAGGGCAAAGAAACTGGCACAAGGTGCAGGCTGCCTCTACTGCTGTTGCTTATAGCAGGCGCTCTTTCTCTCTCCTTCC

TTCTCCCAGAGACACAGTGCTACAGGCAGCTGGGTCTGTCTGCAAGCACACAGGATGAAGGGGTTGCCGCACTGTTTATATATGGTCCAATCTCTCACCA

TCTCTTGAGCAGCTGTTGGCCTATAATCAGCAGATTTCAGTCCAGTCCTCTCATGCAAAGAAACACACGCCCCTCACGTTCTCTGCCGCTGAAGGCTTCC

ATCACTGCCATCACCTAGTAACCATAGCAACCCAACCTACTCTAAAACTAAGCCAAAAATAATACTTCTCTTTGTATAACAACCTCCCCCCCCCCCCCAG

CTCTGGCGAGTTTTTTTTTTTTTTTTTTTTTTTAATGGTCTTCCAACAATCTGAAGCAGAGGATTAGACCATTAGAGTAGTCTATTTGGGGCAGATAGCC

CTTAGAATTTTTTGTTACTGAGGTCCTGGGATTTTAGAGATGATTCTTGGGCCAAACTTTGTAGCCTGATTTTTAAAAGGACATCTATATCACTGCCACC

CAGAACAAAAAGAGGGAATCATTAAATAGGATAGGCCATTAAGAATCTGTAGGACGCCAAATGTTGAGGCCTGGAGGCTAGGCTGGGTACCTTCAAAGAG

AGGGAATTCTCATTACAAGGACAAGCATCACATGACCTCAAAAGAACACAATCATGGTATCTTCGCACTCGAATGTCCTTGATAGAGGGACTCTGGACAA

ACTGTCACACTTTCCAGGAGCCTCTCTGATGGCAACGTTGCACCAGAGAGTGTCTCAGGCTCCTGGAATTCCCTTAGGGTTCTTTAATGAAGAGAAGAAA

ACTTGAATTGTGTTGAATTACTGTATCTTCTGCTTTTTTTTTTTAAAGATAAACTTGTAAATAGAATGATTTGAAATATTATATGGTAAAGTTTTATATT

TGATATTCTTTAAGCTAGTTTGCTCCATACATTTAGTATTTTGATTGCTGAACAGATGTGTTTAAAAGGTTGCAAGAGAGGCCGGGCTAAAGAGTCAAGG

TCATGTCCCCTCTCTGGCCCAGTGAAAGAATGTGTCCTCAATGGTTCCTGTTGGTGAGCCTGGAAAGTTGGTTGCATTCAGTTGTCTTTATCTACATGTG

ATTTGGGGCTTTGGAGTTCAAAAGAGCATCTTCAAGCAGTGAATTTTCAAAGAACTCCCACCCAACAGTAAAGTGACACTCAGGATCTCAGGATTTAAAT

AGGTGGGGTGAGGGCGACATGTTTGTTTTTTGTTTGTGTGTTTGTTCTTCTCAGGTGTATTTCTTGGTACCCCAGGATGTCCAGACAAAAGGAGATGAGC

CAACACTCCTTTTTCCCCCACATCTCCAAGCTAGTTTATAAATGTGTCTATCAACTCTAAGAACTAAACAAGAAAGCCAGCTGCTGTGGTTCTTGGTCAT

TGGTGAACTTTACTCTCTTCCTATAGACGTGTTCCCGCACTTCCCCTTCACCTCCAAAGTCCCGGCAGCCCCAAAGTAAAAAAGAATCCCCAAGATGACA

CTGTTACAGTTTTTAGAGGTGCTGTAATGTTAATAGTTCATTGTCGGGATTCAGTATTGAGTTTACCAGCTCAGGATTATACTGTTGCCAACCAAGGACC

CAGCCAGGAGCAAGGGAGACTTGAACTTTCAGTCAGGCAAACACAGGATTCCAAACTGACAATGCTGGGTGTGATGGCTCATGTGTGGTCTTAGCACTTG

GAAGACAGAGACAAGAGGATTGCTGAAGACTTACGCCAGCCAGATGTGAGGCTGGAGGAGGGTTGCAAACGGAAGGAAGAAAGGCAGTACACTCAGGTTC

CAGACCTATTCCCTGTGAGCTTGAGAAAAGGTTGGGCAATGGGGCCCGAAGGGCATGCACACTCAAGTAGCATTGCTCCTTCCAAATTAAAAGAGCCCAG

CATGATACTTTTAATATATCTGATGGTTTAAATTGTCGCCTGCCCCATAATAAATGAACTATGCTTGTAGTCAGGGCCCAGCACGACTGCTTGGATACAT

ATTCTTTCTCTCCTGAGCTGGCCCTGGTTTGAAACTGCTCTCTTAGGCTGACCTCCTTCCAGTTTCCCTGAGGCCATGTGTGGCCTATGACAGATGGTCG

CTCTGTTTCCCTTTGTCCAGCTAGGCCTCCCTCCTATTCCTCCTCCTCGTCCTCCTCAGGAAAAAGAACTGGAGAGATTAATATGAGCCAAGTAGGAAGG

AACTTGAAGATTAAAAGTGTTATGTGCCCTTTCTGCTCTCTGAACACCCCTGAGCTCCCCACAAATAAGGAAAACTGGGGTAGATCATGAGGAATGAGTT

GATATCAGAATGGAAGTTCATTGACCAGAGTCCCAAAGATTTCCCAGGAGCTTTGAGTTTCTCTTGTAAGACCCTGGGATGGGTTGGTTATGGTTTGAAT

TTTGGAGCATCAAGATGGTTGGTCTTACTCTCTGAGATAGAGAGTTCCATAATTGAACAGTGCCATTCTGTGCTATGAAATGAGAAGATAGCTGCTTTCA

CATCTCTGCCCCCAAGCAAGGAAAATGAGCTTGTTCAACACTGATGAAATTCTCTATTTTTTCTTTTTTTAAAATAAATGTGTGTGACTGACCTCCATTC

AGTGGATGCCTCAGTCTTTAGTATTAGAGCCAGTTTGTAGTATTTTTAAAGCCATTATGTGAAGTCTTGTGGATGCTTTTTTTAATTTTTTTTTTAAATC

AGAGAAGAAATGAGAAGAGAGTACTTCCAACTGGGCACTGGTGAGCCAGAGCCATGCTGGCTGGTTGGGAGTTACAGGCGCTCTAGACCTGAGTGTGCCA

CATCTGGATCTTAAGGGAAATCCTTCTTAACTGCATTCCCCCCCAACCCCCCCAGGACAGTAGCAATCACACCAAAAGCTGCTTCAGTCATAGAACTTCC

AGAAGCATCCATTATTGAGGCAGGGGGAAGTAGACTAAAGAGGGTGAGATCATCTGTTCTTGGCCGGCTATATCTGCTTCCTGTGACAAGGCTGTTTACC

TAGCTTCATAGCCAGCGAGCTTGGGGGTGCACCAGTGACCACACATTTGCCCTGGCACCCACTGTTCTTAGTAGACAAGGGAACCAAGCGTCTGCTTAGC

TACCTGTCTTTCAAAGGAATGTTCTGGCTGTCTAGGAAGGGAGTTGTCTGCCAATTCTGTCAAACTTGACAGTGATCACTTACGTTGATAGCCCTGTCCC

AACAGCCCTTTAATCAGTCAGGTGCCCCTCACTCCCCATAGTAGTGCATGAAAAAATATCTTTTGCATTCAAATATTTCTGCACCCATGCAGATCTAGTG

TTTGTCTGTGAATGTAGTATCAAAATGACAACAGCAGAGAGCTGGGACTGAACCTTGGACATGCCTCCAACATGCTGAGACAAGACTCCACCAGGCGATG

ACGGGCCTTCTTCCCTTTGCCGCCCACAGCACGTGTCTAACTTAAAGAGCCACCCTAAGTAGACAGAGATTCCAGACGTCACTCGGAGGCAGCCCTGTAC

TCATGGAAGGAAAGCATAGATATAAAAACACCCGGATCAGGAAGGAAAGGTGAGCCACCCTGAGAGCAAGAACTAAGCATAGTCCTAACCCACAGAGGGA

GGGCCAAGAACTATCCTGTCAAAATTCACATTAGTGCAGTCAGTGGGGAGCAAGGTTGTGGTAACTCAGTGTCTGAGTGACCTGGAGTAGCTTCAGGCAG

GCTGGCATACTCTCTGCCATCATGCACTCACACATGCATACCTACCATTCTTGCGGCTTCTGAGTAAACACCAACAAACAGCATCCCCGGGGTTCAAGAT

GCCCGAGTCAGCTTGGTGTCTGTGAAAGCATACATGTGGGGATTCTAAAATTTGTGTGTGCGTGTGTTGGTGTGTATGTGTTCGTACATAGCACATACAA

GCATAAAGGTGCCGCCTCGGGTGTAGACACACACACACAAGCTGGCATTTGTAAAGCTCTTACAGCCTTGAAGATTTGGAGGGAAGAGTTTTCAGAGGAA

CTAGAGTCTGTCAGTTTCCTAGCAAAAGATCAAAGCTACAAACGAGCTGTCATCTGAAGCCTCTGTTCGTGTTTATCACATAGTTATCCACAGCTGCGTT

CCTTGGTGACTTATTAAAAGTCAGGTTAAAAACTCAAACCCATAAATTTCCAGTAGCTAATGCTAGGCTAGTGTTCAAAAGCACTCTAAAAGACATTTAG

TCCATATTTTGGGAAAGAAACTATTTGCATGTTTAATTCATCTTTTAGGCTGCTGTTGAGTATACTGTAAAGTGCTGTGTGATATCAAGCCAGTAAAGTA

CTTATAAATGGCACTTTAATATTTTCTTTTGAGAAATCATAAAACACTGTTGTAAATTTCACTATTGAATATTGACTGGTACATAGAATCAAACTCTGTA

ATTAAAAAGTAGCCTGCAGCTAGGATAGAACATTTTTCTTGTTATTAGAGAAAAAAAAAAAGTTTGCCATGTTCAGGCTTTTTAAAAAAAAAGTGTTTCT

GTGCCATTGTTCGTATCTATAAAGAAAATACAATTTCTGTCAGGCATCTCTGAAACCTGGCTTTTTTTATGTTTGGTTCGTGTCTGTGGCAATCCCTATA

AAGTGAGTGGAAGTATGATTTTTGAATTAAATGACTTTCCCATTTGA
Translation
PAPPTPVDRPSSRVSADQRARRVPSARLAPRAEMGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKN - UNI26126 - N

LSSAKRKFADSLNEFKFQCIGDAETDDEMCIA ARSLQEFAAVLRNLEDERSRM IENASEVLITPLEKFRKEQIGAAR EAKKKYDKETEKYCGTLEKH

LNLSSKKKESQLQE ADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEP LLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQN TRNRFEGTRSE

VESLMKKMKENPLEHKTISPYTMEGYLYVQEKR RHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKG GEDESVTLKSCTRRKTDSIEKRFCFDVEAVD

R RPGVITMQALSEEDRRLWMEAMDGREP VYNSNRDSQSEGT TAQLDSIGFSIIRKCIHAVETRG - UNI36579 - GINEQGLYRIVGVNSRVQK

LLSVLMD DPKAASETETDICAEWEIKTVTSALKTYLR RMLPGPLMMYQFQRSFIKAAK KLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLAN NV

ANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEK IFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRPLTLFHAVPSTEKQ

 QEQRNSIINSSLESVSSSANSILNSSSSLQPNLNSSDSNLDVVKPSRPSSL LPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFS

VAAVVLSLAWSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVREDSS STPFRKAKALYACQAEHDSELSFTAGTVFDNV VHPSQEPGWLEGTLNGKTGL

IPENYVEFL

For any suggestions or comments, please send an email to unitrap@crg.es