Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036461 (Elf1)
Chromosomal location
Chr 14: 79881001 - 79982283 (+)
Description
E74-like factor 1 Gene [Source:MGI Symbol;Acc:MGI:107180]
RefSeq_dna
NM_007920 
RefSeq_peptide
NP_031946.1 
UniGene
Mm.301204 
MGI
MGI:107180 
Uniprot/SWISSPROT
Q60775 
Uniprot/SPTREMBL
Q05CC0 Q3U1B2 Q3UQ47 Q3V1H4 
Human Ortholog
ENSG00000120690 (ELF1)
Omim not available
UniTrap UNI34125
Vector Insertion
Chr 14: 79881445 - 79915480
Public Clones IST11884E9 (tigm) IST12457B1 (tigm) IST14167F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16767
Vector Insertion
Chr 14: 79915578 - 79935929
Public Clones IST15068H10 (tigm)
Private Clones OST454698 (lexicon) OST422132 (lexicon) OST405118 (lexicon) OST373397 (lexicon)
OST371394 (lexicon) OST353751 (lexicon) OST337479 (lexicon) OST323286 (lexicon)
OST299414 (lexicon) OST279731 (lexicon) OST276972 (lexicon) OST268926 (lexicon)
OST219362 (lexicon) OST218846 (lexicon) OST212698 (lexicon) OST197064 (lexicon)
OST176834 (lexicon) OST170770 (lexicon) OST165399 (lexicon) OST142540 (lexicon)
OST131945 (lexicon) OST131657 (lexicon) OST115460 (lexicon) OST82245 (lexicon)
OST65040 (lexicon) OST57367 (lexicon) OST56871 (lexicon) OST54198 (lexicon)
OST50042 (lexicon) OST45694 (lexicon) OST43758 (lexicon) OST32753 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27392
Vector Insertion
Chr 14: 79960735 - 79965268
Public Clones IST14960H12 (tigm)
Private Clones OST60868 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14536
Vector Insertion
Chr 14: 79965380 - 79966956
Public Clones FHCRC-GT-S7-1G1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35390
Vector Insertion
Chr 14: 79969112 - 79970529
Public Clones IST10231C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9170
Vector Insertion
Chr 14: 79973426 - 79979991
Public Clones RRE117 (baygenomics) IST11909A12 (tigm) IST12329G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088767
Sequence
CCCCAATCTGCAGGAGCCATTTTAACAGCACAGAACTTGCCGGGTTGCTTTTTAGTTTCAAGCCCAGAGGACGAAACCTGAAGACAAAAGTTTAAAG - 

UNI16767 - GGACAAGAAGACCTAGTGAATGATTTCAGAAAACGTGCCTGTTTTCTTAGAATGTCAATGCAGCAAGCAGGTCTGAAGGACTCCTTTCA

CCGAAGAGCGTCTTGTCTGCAGTAACTTCACAGACCTGCCTGAGAGGCTCTTCCCAAACTCCACTGCACCCTACCTGCTGCTCCAGACTGGAAGCTGCTT

AGGCCTTTTCTCATGTGGATCTAAGGGGAATGCTTTACTATGGCTGCTGTTGTCCAACAGAACGACCTAGTGTTTGAATTTGCAAGTAACGGCATGGAGG

ACGAGCAGCAG CTTGGTGATCCTGCTATATTTCCTGCTGTTATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCTGGTCTAGCTTGTG

TGGAAGAGCCTAATGACATGATTACTGAGAGCTCATTGGATGTTGCTGAAGAAGAAATCATAGACGATGACGATGACGACATCACCCTTACAG - UNI1

4536 - - UNI27392 - ATAATAATATATTTAGCTCCTCTGAAGATGACATCGTTGCCCCAATCACCCATGTGTCCGTCACATTAGATGGGATTCCT

GAAGTGATGGAAACTCAGCAAGTGCAAGAGACAAATGCAGACTCCCCAGGAGCCTCCTCCCCAGAGCAGCGCAAGAGAAAGAAAG GAAGGAAAACAAAA

CCACCACGGCCAGATTCCCCGACGACTACACCAAATATCTCTGTGAAAAAGAAAAATAAAGATGGGAAGG - UNI35390 - GAAACACAATTTACCT

TTGGGAGTTTTTGCTGGCCCTGCTTCAGGACAAAGCTACCTGTCCTAAGTACATCAAGTGGACGCAGCGAGAAAAGGGCATTTTTAAGCTGGTTGATTCT

AAAGCCGTGTCTAGATTGTGGGGGAAGCACAAAAACAAACCTGACATGAACTACGAGACCATGGGGAGAGCACTCAG GTACTATTACCAAAGAGGTATT

CTTGCAAAAGTGGAAGGTCAGCGCTTGGTGTATCAGTTTAAAGAAATGCCAAAAGATCTTATCTACATAGATGATGAGGATCCAAGTTCCAGCATAGAGT

CTTCGGATCAGTCCTTATCGTCAACAACCGCATCAAGTCGGAATCAAGCAAACCGATCAAGAGTATCTTCAAGTCCAGGAATTAAAGGAGGGGCCGCTAC

AATTCTAAAGCCCGGGAATTCTAAAGCTGCAAACCCCAAAGATCCGGTGGAAGTTGGACAACCTTCAGAAGTTCTGAGGACAGTGCAACCCTCACAGGCT

CCCTATCCTACCCAGCTCTTCCGAACTGTTCATGTAGTACAGCCAGTACAAGCTGTCCCAGAGGAAGCAACCATAGCCAGCACCATGCAGGAGGAAGCAG

CAAATTCTTCAGTTCCAAGTATTAG - UNI9170 - GACTATACAGGCTTCAACCCAGGTTCCAGTAGTGGTGTCTCCTGGCAACCAACAGTTACATA

CAGTAACAGTGCCACTCACAACGGTTATAGCCAGCATAGACCCATCATCAGGTGCTGGGTCTCAGAAATTCATTTTACAAACCATTCCATCGTCACAGCC

CATGACAGTACTGAAAGAAAATGTCATGCTACAGTCACAGAAGCCAGGCTCTCCTTCAATTGTCCTCAGCCCCACCCAAGTACAGCAGGTCCTCACAAGC

AATGTTCAGTCCATTTGCAATGGAGCGGGCAGTGTGGCATCCGCACCATCGTTCAGCGCGACGACACCTGTGGTGACTTTCTCTCGGAGTTCACAGCTGG

TCGCACACCCACCGGGCACTGTGATCACTTCTGTTATCAAAGCTCAGGAAACAAAAACTCTTAAGCAAGAGGTGGAGAAAAAGGCCGAAGATGATTTGAA

TGAAGATGCTGAGAAAAGTGCCCAGCAGCCCCAGCCTTATGTGATGGTGTTATCCAGTTCAAACGGGTTTTCCTCTCAGGTAGCCGTCAAACAGAATGAA

CTGCTAGAGCCCAACTCTTTTTAATACACCAAAGGAATTATGGGTGGGTATTTTTTTAATTGAACTCATTTTTCGGTTGTCTGACCATAACATGATTTTT

TTCTAAGATGAAATCCACAGAAGTTCTTAACTGTTAAAAAGTTACTTTTGACTTTGCTAGATAAGGAGGCGAACCCAAGTGTGTGTCTCCTCTGAATGTC

TCAGAACTCAGTTGTGAAGGAGCAGGAGGTTTAGACGATGAAGAAATTCTTGACTGTTTTTCAGTTGCTATATCATATTTTAAAAGTTTCTTTTCTAGCT

TGACACTGTACTAGCTTCCTGAATTGTTTGAAAATACTACTTAAATATAAGACAACAGGAAATTTATATAGGAAACATTTTCATTCCACTTGTATAATTT

AAGTCTTAGCTCTTTCAGATGCAAGAAACTTATACTATTAAAATTGTTGCGATGTCACTTAGCTTGACTTTAAAGTTGGCTGGACTGTTATACTATGAAT

ATACTACGAATTTGTAAACTATCATTATAAATTGAAGTGTATATGCTCAGTATATTGGCATATATGTGTAATTCCAGCACTGGGAGGAGGACAAAGGGCA

ATCAGGAGTTCAAGGCCAGCCTTAGCTATATAGTGAGTTTGAAGCCAGCCTGGGCTACATGTAACCTTCCCAAAAAAATCCAAAACAACAACAAAAATAT

TTAAGTGTGCCTATGATAATGTCTGAACCTGAGTTTAAGAAATGTGATGTAGCCGGGCGTGGTGGCACACGCCTTTAATCCCAGCACTTGGGAGGCAGAC

GCAGGTGAATTTCTGAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTATACAGAAACCCTGTCTCAAAACAAACAAACAAAT

AAAAAAAGAAATGTGATATTATAAAGGCAACACTTGTGACACTTCCACTAGCTAGGTGTGTAACCCTGGGTAGGCCACTCCATCTCCTAGGTGTGTAACC

CTGGACAGGACATTTCACCTGCTAGTCTGTGCTATTCTGGTAAAATGAAGGGATGCATTGGACTAGACAAAATGATCTAAAAGTTTCCTTATTATAAATT

TTAGGATTTTATTATCTGTACTTTAAAATTATTTCAAATATTACCAGATTATCTCCTTATGTAAAGGTAAAATACTGCTTAAAAATATTTTCCTCACAAA

ATTACTATCAGGTCTGCCATAAATTCTTCCTAAGTTCTCTGCTCATTAATCTTCAGACCACAGTTACTAAAACTGTGGCTTAGTAGTAAGCTGAGGGCTA

AATGAGAGACTGCTATTCTAAGAGCATCAGGGCTCTGAGGGCCAAAGAAGCAATGGGAGTCCTGAGCTAGTATAGCTGTGTCACTTATTATAAAAGCATA

ACTGTTTTTTATTTGGATCATTTTTTACTGTGGGTGAAGGGGAGGGGAAGTTGCATACAAAGATATATATCCAAGTTTCCGAAGTAGAGTTTTTAGATTA

CTTTTTCAATGTAAATAATGTATATTTAATGTCACAAGAAATTGTTTTCTGCAAATTCTCTAGTATAGAAAGTTTTGTAGAAGAAAAATTATTGTGTTTA

GGGGTATAATATTATATGTTTTCATATTATGAAATGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTCTAAACATTTTTGTATCTTTAATTGT

TATTATTAAATCATGTAAAAGTTCTCAAT
Translation
 - UNI16767 - MAAVVQQNDLVFEFASNGMEDEQQ LGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAEEEIIDDDDDDITLTD

 - UNI14536 - - UNI27392 - DNNIFSSSEDDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKG GRKTKPPRPDSPTTTP

NISVKKKNKDGKG - UNI35390 - GNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALR RYYYQRG

ILAKVEGQRLVYQFKEMPKDLIYIDDEDPSSSIESSDQSLSSTTASSRNQANRSRVSSSPGIKGGAATILKPGNSKAANPKDPVEVGQPSEVLRTVQPSQ

APYPTQLFRTVHVVQPVQAVPEEATIASTMQEEAANSSVPSIR - UNI9170 - RTIQASTQVPVVVSPGNQQLHTVTVPLTTVIASIDPSSGAGSQK

FILQTIPSSQPMTVLKENVMLQSQKPGSPSIVLSPTQVQQVLTSNVQSICNGAGSVASAPSFSATTPVVTFSRSSQLVAHPPGTVITSVIKAQETKTLKQ

EVEKKAEDDLNEDAEKSAQQPQPYVMVLSSSNGFSSQVAVKQNELLEPNSF
Transcript ENSMUST00000110835
Sequence
CCCCAATCTGCAGGAGCCATTTTAACAGCACAGAACTTGCCGGGTTGCTTTTTAGTTTCAAGCCCAGAGGACGAAACCTGAAGACAAAAGTTTAAAG - 

UNI16767 - GGACAAGAAGACCTAGTGAATGATTTCAGAAAACGTGCCTGTTTTCTTAGAATGTCAATGCAGCAAGCAGGTCTGAAGGACTCCTTTCA

CCGAAGAGCGTCTTGTCTGCAGTAACTTCACAGACCTGCCTGAGAGGCTCTTCCCAAACTCCACTGCACCCTACCTGCTGCTCCAGACTGGAAGCTGCTT

AGGCCTTTTCTCATGTGGATCTAAGGGGAATGCTTTACTATGGCTGCTGTTGTCCAACAGAACGACCTAGTGTTTGAATTTGCAAGTAACGGCATGGAGG

ACGAGCAGCAG CTTGGTGATCCTGCTATATTTCCTGCTGTTATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCTGGTCTAGCTTGTG

TGGAAGAGCCTAATGACATGATTACTGAGAGCTCATTGGATGTTGCTGAAGAAGAAATCATAGACGATGACGATGACGACATCACCCTTACAG - UNI2

7392 - TTGAGGCTTCTTGTCATAATGGAGATGAAACAATTGAGACCATTGAGGCTGCCGAGGCACTCCTCAATATAGATTCTCCCAGCCCTCCTGTAC

TGGATGAAAAGCAAATCA - UNI14536 - ATAATAATATATTTAGCTCCTCTGAAGATGACATCGTTGCCCCAATCACCCATGTGTCCGTCACATTA

GATGGGATTCCTGAAGTGATGGAAACTCAGCAAGTGCAAGAGACAAATGCAGACTCCCCAGGAGCCTCCTCCCCAGAGCAGCGCAAGAGAAAGAAAG GA

AGGAAAACAAAACCACCACGGCCAGATTCCCCGACGACTACACCAAATATCTCTGTGAAAAAGAAAAATAAAGATGGGAAGG - UNI35390 - GAAA

CACAATTTACCTTTGGGAGTTTTTGCTGGCCCTGCTTCAGGACAAAGCTACCTGTCCTAAGTACATCAAGTGGACGCAGCGAGAAAAGGGCATTTTTAAG

CTGGTTGATTCTAAAGCCGTGTCTAGATTGTGGGGGAAGCACAAAAACAAACCTGACATGAACTACGAGACCATGGGGAGAGCACTCAG GTACTATTAC

CAAAGAGGTATTCTTGCAAAAGTGGAAGGTCAGCGCTTGGTGTATCAGTTTAAAGAAATGCCAAAAGATCTTATCTACATAGATGATGAGGATCCAAGTT

CCAGCATAGAGTCTTCGGATCAGTCCTTATCGTCAACAACCGCATCAAGTCGGAATCAAGCAAACCGATCAAGAGTATCTTCAAGTCCAGGAATTAAAGG

AGGGGCCGCTACAATTCTAAAGCCCGGGAATTCTAAAGCTGCAAACCCCAAAGATCCGGTGGAAGTTGGACAACCTTCAGAAGTTCTGAGGACAGTGCAA

CCCTCACAGGCTCCCTATCCTACCCAGCTCTTCCGAACTGTTCATGTAGTACAGCCAGTACAAGCTGTCCCAGAGGAAGCAACCATAGCCAGCACCATGC

AGGAGGAAGCAGCAAATTCTTCAGTTCCAAGTATTAG - UNI9170 - GACTATACAGGCTTCAACCCAGGTTCCAGTAGTGGTGTCTCCTGGCAACC

AACAGTTACATACAGTAACAGTGCCACTCACAACGGTTATAGCCAGCATAGACCCATCATCAGGTGCTGGGTCTCAGAAATTCATTTTACAAACCATTCC

ATCGTCACAGCCCATGACAGTACTGAAAGAAAATGTCATGCTACAGTCACAGAAGCCAGGCTCTCCTTCAATTGTCCTCAGCCCCACCCAAGTACAGCAG

GTCCTCACAAGCAATGTTCAGTCCATTTGCAATGGAGCGGGCAGTGTGGCATCCGCACCATCGTTCAGCGCGACGACACCTGTGGTGACTTTCTCTCGGA

GTTCACAGCTGGTCGCACACCCACCGGGCACTGTGATCACTTCTGTTATCAAAGCTCAGGAAACAAAAACTCTTAAGCAAGAGGTGGAGAAAAAGGCCGA

AGATGATTTGAATGAAGATGCTGAGAAAAGTGCCCAGCAGCCCCAGCCTTATGTGATGGTGTTATCCAGTTCAAACGGGTTTTCCTCTCAGGTAGCCGTC

AAACAGAATGAACTGCTAGAGCCCAACTCTTTTTAATACACCAAAGGAATTATGGGTGGGTATTTTTTTAATTGAACTCATTTTTCGGTTGTCTGACCAT

AACATGATTTTTTTCTAAGATGAAATCCACAGAAGTTCTTAACTGTTAAAAAGTTACTTTTGACTTTGCTAGATAAGGAGGCGAACCCAAGTGTGTGTCT

CCTCTGAATGTCTCAGAACTCAGTTGTGAAGGAGCAGGAGGTTTAGACGATGAAGAAATTCTTGACTGTTTTTCAGTTGCTATATCATATTTTAAAAGTT

TCTTTTCTAGCTTGACACTGTACTAGCTTCCTGAATTGTTTGAAAATACTACTTAAATATAAGACAACAGGAAATTTATATAGGAAACATTTTCATTCCA

CTTGTATAATTTAAGTCTTAGCTCTTTCAGATGCAAGAAACTTATACTATTAAAATTGTTGCGATGTCACTTAGCTTGACTTTAAAGTTGGCTGGACTGT

TATACTATGAATATACTACGAATTTGTAAACTATCATTATAAATTGAAGTGTATATGCTCAGTATATTGGCATATATGTGTAATTCCAGCACTGGGAGGA

GGACAAAGGGCAATCAGGAGTTCAAGGCCAGCCTTAGCTATATAGTGAGTTTGAAGCCAGCCTGGGCTACATGTAACCTTCCCAAAAAAATCCAAAACAA

CAACAAAAATATTTAAGTGTGCCTATGATAATGTCTGAACCTGAGTTTAAGAAATGTGATGTAGCCGGGCGTGGTGGCACACGCCTTTAATCCCAGCACT

TGGGAGGCAGACGCAGGTGAATTTCTGAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTATACAGAAACCCTGTCTCAAAAC

AAACAAACAAATAAAAAAAGAAATGTGATATTATAAAGGCAACACTTGTGACACTTCCACTAGCTAGGTGTGTAACCCTGGGTAGGCCACTCCATCTCCT

AGGTGTGTAACCCTGGACAGGACATTTCACCTGCTAGTCTGTGCTATTCTGGTAAAATGAAGGGATGCATTGGACTAGACAAAATGATCTAAAAGTTTCC

TTATTATAAATTTTAGGATTTTATTATCTGTACTTTAAAATTATTTCAAATATTACCAGATTATCTCCTTATGTAAAGGTAAAATACTGCTTAAAAATAT

TTTCCTCACAAAATTACTATCAGGTCTGCCATAAATTCTTCCTAAGTTCTCTGCTCATTAATCTTCAGACCACAGTTACTAAAACTGTGGCTTAGTAGTA

AGCTGAGGGCTAAATGAGAGACTGCTATTCTAAGAGCATCAGGGCTCTGAGGGCCAAAGAAGCAATGGGAGTCCTGAGCTAGTATAGCTGTGTCACTTAT

TATAAAAGCATAACTGTTTTTTATTTGGATCATTTTTTACTGTGGGTGAAGGGGAGGGGAAGTTGCATACAAAGATATATATCCAAGTTTCCGAAGTAGA

GTTTTTAGATTACTTTTTCAATGTAAATAATGTATATTTAATGTCACAAGAAATTGTTTTCTGCAAATTCTCTAGTATAGAAAGTTTTGTAGAAGAAAAA

TTATTGTGTTTAGGGGTATAATATTATATGTTTTCATATTATGAAATGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTCTAAACATTTTTGT

ATCTTTAATTGTTATTATTAAATCATGTAAAAGTTCTCAAT
Translation
 - UNI16767 - MAAVVQQNDLVFEFASNGMEDEQQ LGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAEEEIIDDDDDDITLTV

 - UNI27392 - VEASCHNGDETIETIEAAEALLNIDSPSPPVLDEKQIN - UNI14536 - NNNIFSSSEDDIVAPITHVSVTLDGIPEVMETQQ

VQETNADSPGASSPEQRKRKKG GRKTKPPRPDSPTTTPNISVKKKNKDGKG - UNI35390 - GNTIYLWEFLLALLQDKATCPKYIKWTQREKGIF

KLVDSKAVSRLWGKHKNKPDMNYETMGRALR RYYYQRGILAKVEGQRLVYQFKEMPKDLIYIDDEDPSSSIESSDQSLSSTTASSRNQANRSRVSSSPG

IKGGAATILKPGNSKAANPKDPVEVGQPSEVLRTVQPSQAPYPTQLFRTVHVVQPVQAVPEEATIASTMQEEAANSSVPSIR - UNI9170 - RTIQA

STQVPVVVSPGNQQLHTVTVPLTTVIASIDPSSGAGSQKFILQTIPSSQPMTVLKENVMLQSQKPGSPSIVLSPTQVQQVLTSNVQSICNGAGSVASAPS

FSATTPVVTFSRSSQLVAHPPGTVITSVIKAQETKTLKQEVEKKAEDDLNEDAEKSAQQPQPYVMVLSSSNGFSSQVAVKQNELLEPNSF
Transcript ENSMUST00000040131
Sequence
CCGGAGCCGCGGGCCCCGAGCGTCCGACCCAGGCTCCATCCCGCGGTCCTCACGCCTCCCGGGATCCAGAACCTCCACTCCCGAGCTGGCTCGCAGCCGA

GAGGCTCGATCGCCTCCCCCCAGCCCCGGCCGCACGCCGCCGTTCCCACAGCCGGCGCCGCCCTCGGCTTTGCCGGCTTGCCCGCCCGCTCTGTGACCGG

GGAGCAGCCCGGGACCTGACGGCTGAGAAAGAAAGGCGCAGCCGCCCGTTCCGGGAGCGCACGGGGCGCCCGGCTTCGGCTCAGAACTTTCCAGGGGCGC

GCACCGGCCCCGCTCCTCCCCCCCGCCACGCCCGCGCGCTCCGCCGGGCTCGTGCCCGCGCGTGGGGCAGCGGCCGCGGGGGCGGCTTCGGCGGCGCGAG

TTGCAGCAGAGTGGCTGAGTGGTAGCGGCGCTGACGCTAGTCAG - UNI16767 - - UNI34125 - GGACAAGAAGACCTAGTGAATGATTTCAG

AAAACGTGCCTGTTTTCTTAGAATGTCAATGCAGCAAGCAGGTCTGAAGGACTCCTTTCACCGAAGAGCGTCTTGTCTGCAGTAACTTCACAGACCTGCC

TGAGAGGCTCTTCCCAAACTCCACTGCACCCTACCTGCTGCTCCAGACTGGAAGCTGCTTAGGCCTTTTCTCATGTGGATCTAAGGGGAATGCTTTACTA

TGGCTGCTGTTGTCCAACAGAACGACCTAGTGTTTGAATTTGCAAGTAACGGCATGGAGGACGAGCAGCAG CTTGGTGATCCTGCTATATTTCCTGCTG

TTATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCTGGTCTAGCTTGTGTGGAAGAGCCTAATGACATGATTACTGAGAGCTCATTGGA

TGTTGCTGAAGAAGAAATCATAGACGATGACGATGACGACATCACCCTTACAG - UNI27392 - TTGAGGCTTCTTGTCATAATGGAGATGAAACAA

TTGAGACCATTGAGGCTGCCGAGGCACTCCTCAATATAGATTCTCCCAGCCCTCCTGTACTGGATGAAAAGCAAATCA - UNI14536 - ATAATAAT

ATATTTAGCTCCTCTGAAGATGACATCGTTGCCCCAATCACCCATGTGTCCGTCACATTAGATGGGATTCCTGAAGTGATGGAAACTCAGCAAGTGCAAG

AGACAAATGCAGACTCCCCAGGAGCCTCCTCCCCAGAGCAGCGCAAGAGAAAGAAAG GAAGGAAAACAAAACCACCACGGCCAGATTCCCCGACGACTA

CACCAAATATCTCTGTGAAAAAGAAAAATAAAGATGGGAAGG - UNI35390 - GAAACACAATTTACCTTTGGGAGTTTTTGCTGGCCCTGCTTCAG

GACAAAGCTACCTGTCCTAAGTACATCAAGTGGACGCAGCGAGAAAAGGGCATTTTTAAGCTGGTTGATTCTAAAGCCGTGTCTAGATTGTGGGGGAAGC

ACAAAAACAAACCTGACATGAACTACGAGACCATGGGGAGAGCACTCAG GTACTATTACCAAAGAGGTATTCTTGCAAAAGTGGAAGGTCAGCGCTTGG

TGTATCAGTTTAAAGAAATGCCAAAAGATCTTATCTACATAGATGATGAGGATCCAAGTTCCAGCATAGAGTCTTCGGATCAGTCCTTATCGTCAACAAC

CGCATCAAGTCGGAATCAAGCAAACCGATCAAGAGTATCTTCAAGTCCAGGAATTAAAGGAGGGGCCGCTACAATTCTAAAGCCCGGGAATTCTAAAGCT

GCAAACCCCAAAGATCCGGTGGAAGTTGGACAACCTTCAGAAGTTCTGAGGACAGTGCAACCCTCACAGGCTCCCTATCCTACCCAGCTCTTCCGAACTG

TTCATGTAGTACAGCCAGTACAAGCTGTCCCAGAGGAAGCAACCATAGCCAGCACCATGCAGGAGGAAGCAGCAAATTCTTCAGTTCCAAGTATTAG - 

UNI9170 - GACTATACAGGCTTCAACCCAGGTTCCAGTAGTGGTGTCTCCTGGCAACCAACAGTTACATACAGTAACAGTGCCACTCACAACGGTTAT

AGCCAGCATAGACCCATCATCAGGTGCTGGGTCTCAGAAATTCATTTTACAAACCATTCCATCGTCACAGCCCATGACAGTACTGAAAGAAAATGTCATG

CTACAGTCACAGAAGCCAGGCTCTCCTTCAATTGTCCTCAGCCCCACCCAAGTACAGCAGGTCCTCACAAGCAATGTTCAGTCCATTTGCAATGGAGCGG

GCAGTGTGGCATCCGCACCATCGTTCAGCGCGACGACACCTGTGGTGACTTTCTCTCGGAGTTCACAGCTGGTCGCACACCCACCGGGCACTGTGATCAC

TTCTGTTATCAAAGCTCAGGAAACAAAAACTCTTAAGCAAGAGGTGGAGAAAAAGGCCGAAGATGATTTGAATGAAGATGCTGAGAAAAGTGCCCAGCAG

CCCCAGCCTTATGTGATGGTGTTATCCAGTTCAAACGGGTTTTCCTCTCAGGTAGCCGTCAAACAGAATGAACTGCTAGAGCCCAACTCTTTTTAATACA

CCAAAGGAATTATGGGTGGGTATTTTTTTAATTGAACTCATTTTTCGGTTGTCTGACCATAACATGATTTTTTTCTAAGATGAAATCCACAGAAGTTCTT

AACTGTTAAAAAGTTACTTTTGACTTTGCTAGATAAGGAGGCGAACCCAAGTGTGTGTCTCCTCTGAATGTCTCAGAACTCAGTTGTGAAGGAGCAGGAG

GTTTAGACGATGAAGAAATTCTTGACTGTTTTTCAGTTGCTATATCATATTTTAAAAGTTTCTTTTCTAGCTTGACACTGTACTAGCTTCCTGAATTGTT

TGAAAATACTACTTAAATATAAGACAACAGGAAATTTATATAGGAAACATTTTCATTCCACTTGTATAATTTAAGTCTTAGCTCTTTCAGATGCAAGAAA

CTTATACTATTAAAATTGTTGCGATGTCACTTAGCTTGACTTTAAAGTTGGCTGGACTGTTATACTATGAATATACTACGAATTTGTAAACTATCATTAT

AAATTGAAGTGTATATGCTCAGTATATTGGCATATATGTGTAATTCCAGCACTGGGAGGAGGACAAAGGGCAATCAGGAGTTCAAGGCCAGCCTTAGCTA

TATAGTGAGTTTGAAGCCAGCCTGGGCTACATGTAACCTTCCCAAAAAAATCCAAAACAACAACAAAAATATTTAAGTGTGCCTATGATAATGTCTGAAC

CTGAGTTTAAGAAATGTGATGTAGCCGGGCGTGGTGGCACACGCCTTTAATCCCAGCACTTGGGAGGCAGACGCAGGTGAATTTCTGAGTTTGAGGCCAG

CCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTATACAGAAACCCTGTCTCAAAACAAACAAACAAATAAAAAAAGAAATGTGATATTATAAAGGC

AACACTTGTGACACTTCCACTAGCTAGGTGTGTAACCCTGGGTAGGCCACTCCATCTCCTAGGTGTGTAACCCTGGACAGGACATTTCACCTGCTAGTCT

GTGCTATTCTGGTAAAATGAAGGGATGCATTGGACTAGACAAAATGATCTAAAAGTTTCCTTATTATAAATTTTAGGATTTTATTATCTGTACTTTAAAA

TTATTTCAAATATTACCAGATTATCTCCTTATGTAAAGGTAAAATACTGCTTAAAAATATTTTCCTCACAAAATTACTATCAGGTCTGCCATAAATTCTT

CCTAAGTTCTCTGCTCATTAATCTTCAGACCACAGTTACTAAAACTGTGGCTTAGTAGTAAGCTGAGGGCTAAATGAGAGACTGCTATTCTAAGAGCATC

AGGGCTCTGAGGGCCAAAGAAGCAATGGGAGTCCTGAGCTAGTATAGCTGTGTCACTTATTATAAAAGCATAACTGTTTTTTATTTGGATCATTTTTTAC

TGTGGGTGAAGGGGAGGGGAAGTTGCATACAAAGATATATATCCAAGTTTCCGAAGTAGAGTTTTTAGATTACTTTTTCAATGTAAATAATGTATATTTA

ATGTCACAAGAAATTGTTTTCTGCAAATTCTCTAGTATAGAAAGTTTTGTAGAAGAAAAATTATTGTGTTTAGGGGTATAATATTATATGTTTTCATATT

ATGAAATGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTCTAAACATTTTTGTATCTTTAATTGTTATTATTAAATCATGTAAAAGTTCTCAA

TA
Translation
 - UNI16767 - - UNI34125 - MAAVVQQNDLVFEFASNGMEDEQQ LGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAEEE

IIDDDDDDITLTV - UNI27392 - VEASCHNGDETIETIEAAEALLNIDSPSPPVLDEKQIN - UNI14536 - NNNIFSSSEDDIVAPITHVSV

TLDGIPEVMETQQVQETNADSPGASSPEQRKRKKG GRKTKPPRPDSPTTTPNISVKKKNKDGKG - UNI35390 - GNTIYLWEFLLALLQDKATCP

KYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALR RYYYQRGILAKVEGQRLVYQFKEMPKDLIYIDDEDPSSSIESSDQSLSSTTASSR

NQANRSRVSSSPGIKGGAATILKPGNSKAANPKDPVEVGQPSEVLRTVQPSQAPYPTQLFRTVHVVQPVQAVPEEATIASTMQEEAANSSVPSIR - UN

I9170 - RTIQASTQVPVVVSPGNQQLHTVTVPLTTVIASIDPSSGAGSQKFILQTIPSSQPMTVLKENVMLQSQKPGSPSIVLSPTQVQQVLTSNVQS

ICNGAGSVASAPSFSATTPVVTFSRSSQLVAHPPGTVITSVIKAQETKTLKQEVEKKAEDDLNEDAEKSAQQPQPYVMVLSSSNGFSSQVAVKQNELLEP

NSF

For any suggestions or comments, please send an email to unitrap@crg.es