Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036466 (Megf11)
Chromosomal location
Chr 9: 64233433 - 64557012 (+)
Description
multiple EGF-like-domains 11 Gene [Source:MGI (curated);Acc:Megf11-002]
RefSeq_dna
NM_172522 
RefSeq_peptide
NP_766110.3 
UniGene
Mm.127721 
MGI
MGI:1920951 
Uniprot/SWISSPROT
Q80T91 
Human Ortholog
ENSG00000157890 (MEGF11)
Omim not available
UniTrap UNI29674
Vector Insertion
Chr 9: 64233636 - 64349329
Public Clones (sanger) E121F07 (ggtc) IST14536H6 (tigm) IST14736E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25306
Vector Insertion
Chr 9: 64349329 - 64349431
Public Clones not available
Private Clones OST188193 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19628
Vector Insertion
Chr 9: 64349431 - 64353834
Public Clones not available
Private Clones OST385862 (lexicon) OST307203 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38726
Vector Insertion
Chr 9: 64356616 - 64392400
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096838
Sequence
CGTTCTCAGTGCCCGGAGCCGGCTGCCCGGCTCGGGGCGGTTCGCAGCTCCCTCTCCTGCCTGGGGACCTGAAGCCGCTCCGGCTCCGGGGTATAGGACC

GCGCGACTGGCTGGCCCAAGCCCGGGGCGCGCCACGGAAGCAG - UNI25306 - - UNI29674 - GCCCCGATGGCGCCGTCTGCGGTGGGCCTC

CTTGTCTTCCTTCTGCAAGCTGCTCTTGCTCTGAACCCTGAAGACCCCAATGTGTGTAGCCACTGGGAGAG - UNI19628 - - UNI25306 - CT

ATGCCGTGACTGTGCAGGAGTCTTATGCACACCCCTTTGATCAGATCTACTACACACGATGTGCAGACATCCTCAACTGGTTCAAGTGTACCCGGCACCG

 GATCAGCTATAAGACCGCGTATAGGCGCGGCCTCCGGACCATGTACCGGCGGAGGTCCCAATGCTGCCCTGGCTACTATGAGAACGGAGACTTCTGCAT

TC CTCTGTGTACCGAGGAGTGCATGCACGGCCGCTGTGTCTCTCCCGATACCTGCCACTGTGAGCCTGGATGGGGAGGCCCTGACTGCTCCAGCG GCT

GTGACAGCGAGCACTGGGGTCCCCACTGCAGCAACCGGTGTCAGTGTCAGAACGGCGCCCTGTGCAACCCTATCACCGGCGCCTGCGTGTGCGCCCCGGG

CTTCCGAGGCTGGCGCTGTGAGGAACTCTGCGCTCCTGGTACTCACGGCAAGGGCTGCCAGCTGCTCTGTCAGTGCCACCATGGCGCCAGCTGTGACCCG

CGCACTGGCGAGTGCCTCTGCGCTCCTGGCTACACAGGCGTTTA CTGTGAGGAGCTGTGCCCCCCTGGGAGCCATGGAGCTCACTGTGAGCTGCGCTGC

CCCTGCCAGAATGGAGGCACCTGCCACCACATCACTGGCGAATGTGCCTGCCCTCCAGGCTGGACG GGAGCAGTGTGTGCCCAGCCCTGCCCTCCAGGG

ACCTTTGGCCAGAACTGTAGCCAGGACTGTCCCTGCCACCATGGAGGCCAGTGTGACCATGTGACTGGACAATGCCACTGTACAGCTGGATACATGGGGG

ACAG GTGTCAAGAAGAATGTCCCTTTGGAACGTTCGGTTTCCTGTGCTCTCAACGCTGTGACTGCCACAATGGAGGTCAATGTTCACCAGCCACAGGGG

CCTGTGAGTGTGAGCCTGGCTACAAGGGCCCTAGCTGCCAGGAGCGGCTATGCCCTGAGGGCCTGCATGGCCCAGGCTGCACCTTGCCCTGCCCCTGTGA

CACCGAGAACACTATCAG CTGCCATCCAGTTACTGGAGCTTGTACCTGCCAACCAGGCTGGTCTGGCCACTACTGCAATGAGTCCTGCCCCGCCGGCTA

CTATGGCAACGGTTGCCAGCTACCCTGCACCTGCCAGAACGGTGCTGACTGCCACAGTATCACCGGGAGCTGCACTTGTGCTCCAGGCTTCATG GGAGA

GGTGTGTGCCGTCCCCTGTGCTGCAGGGACCTATGGTCCCAACTGTTCATCTGTATGTAGCTGTAGCAACGGCGGCACCTGTTCCCCAGTGGATGGCTCC

TGCACCTGCCGAGAGG GATGGCAGGGCCTGGACTGCTCCCTGCCTTGTCCCAGTGGGACCTGGGGCCTGAACTGCAATGAGACTTGCATCTGTGCCAAT

GGAGCTGCCTGCAGCCCCTTTGATGGGTCCTGTGCCTGCACCCCAGGCTGGCTGGGGGACTCCTGTGAACTGCCCTGCCCG GACGGCACTTTTGGGCTG

AACTGCAGTGAGCATTGCGACTGCAGCCATGCTGATGGCTGTGACCCTGTCACAGGCCACTGCTGCTGCCTGGCAGGATGGACAG GCATCCGCTGTGAT

AGCACGTGTCCTCCAGGTCGCTGGGGCCCCAACTGTTCAGTGTCCTGCAGCTGTGAGAACGGAGGTTCCTGCTCCCCGGAGGACGGGAGCTGCGAGTGTG

CCCCTGGCTTTCGAGGACCCTTATGTCAGAGAA TCTGCCCACCAGGATTCTACGGCCATGGCTGCGCCCAGCCTTGTCCCCTCTGCGTGCACAGCAGGG

GGCCCTGCCACCACATCAGTGGTATCTGTGAGTGCCTGCCAGGATTCTCTGGAGCCTTGTGCAACCAAG TGTGTGCTGGAGGGCACTTCGGGCAGGACT

GTGCCCAGCTCTGTTCCTGTGCCAACAATGGGACCTGCAGCCCCATCGATGGCTCCTGTCAGTGCTTCCCTGGGTGGATTGGCAAGGACTGCTCACAGG 

CCTGCCCATCTGGGTTCTGGGGCTCTGCCTGCTTCCACACATGCAGCTGCCACAACGGGGCGAGCTGCAGCGCCGAGGATGGGGCCTGCCACTGCACCCC

TGGCTGGACTGGACTCTTCTGCACGCAGC GTTGCCCTTCAGCATTTTTTGGGAAGGACTGTGGGCACATATGCCAGTGTCAGAATGGAGCCAGCTGTGA

CCACATCACTGGGAAATGCACCTGTCGAACAGGCTTCTCTGGCCGCCACTGTGAACAGA GATGTGCCCCTGGAACCTTTGGATATGGGTGTCAGCAGCT

ATGTGAGTGCATGAACAATGCCACTTGTGACCACGTCACTGGTACCTGTTACTGTAGCCCGGGATTCAAAGGAATCAGGTGTGACCAAG CTGCCCTCAT

GATGGATGAGCTGAATCCCTACACCAAGATCAGTCCAGCTCTGGGAGCAGAGCGGCACTCAGTGGGTGCTGTCACCGGCATCGTTCTCCTGTTGTTCCTG

GTGGTGGTGCTGCTGGGCCTGTTTGCCTGGCGACGGAGGCGGCAGAAAGAGAAAGGCCGTGACCTGGCTCCCCGAGTCTCCTACACCCCAGCCATGAGGA

TGACCAGCACAGACTACTCTCTCTCAG GCACTTGTGGAATGGACAGACGTCAGAACACATACATTATGGACAAAGGCTTCAAAG ATTACATGAAAGAA

TCTGTGTGCAGTTCTAGCACTTGCTCCTTGAACAGCAGTGAAAACCCTTACGCCACAATTAAGGACCCACCCATCCTCACCTGCAAGCTTCCAGAAAGCA

GTTATGTAGAAATGAAGTCACCTGTGCACTTGGGGTCTCCGTACACAGATGTGCCATCCTTGTCGACATCTAATAAAAATATATATGAAGTTG AGCCCA

CAGTCAGTGTGGTCCAAGAAGGCCGAGGTCATAACTCCAGCTATATCCAGAATCCATACGACCTACCTAAGAACAGCCATATTCCTGGTCACTATGACCT

CCTCCCAGTAAGACAGAGCCCTGCCCATGGGCCCTTCCAGGAAAAGCAGTAA
Translation
 - UNI25306 - - UNI29674 -  - UNI19628 - - UNI25306 -        M GEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCT

CREG GWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCP DGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTG GIR

CDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRI ICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQV VCAGG

HFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQA ACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQR RCPSAFFGKDCGHIC

QCQNGASCDHITGKCTCRTGFSGRHCEQR RCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQA AALMMDELNPYTKISPALGAERHSV

GAVTGIVLLLFLVVVLLGLFAWRRRRQKEKGRDLAPRVSYTPAMRMTSTDYSLSG GTCGMDRRQNTYIMDKGFKD DYMKESVCSSSTCSLNSSENPYA

TIKDPPILTCKLPESSYVEMKSPVHLGSPYTDVPSLSTSNKNIYEVE EPTVSVVQEGRGHNSSYIQNPYDLPKNSHIPGHYDLLPVRQSPAHGPFQEKQ

Transcript ENSMUST00000093829
Sequence
CTCAGTGCCCGGAGCCGGCTGCCCGGCTCGGGGCGGTTCGCAGCTCCCTCTCCTGCCTGGGGACCTGAAGCCGCTCCGGCTCCGGGGTATAGGACCGCGC

GACTGGCTGGCCCAAGCCCGGGGCGCGCCACGGAAGCAG - UNI25306 - - UNI29674 - GCCCCGATGGCGCCGTCTGCGGTGGGCCTCCTTG

TCTTCCTTCTGCAAGCTGCTCTTGCTCTGAACCCTGAAGACCCCAATGTGTGTAGCCACTGGGAGAG - UNI19628 - - UNI25306 - CTATGC

CGTGACTGTGCAGGAGTCTTATGCACACCCCTTTGATCAGATCTACTACACACGATGTGCAGACATCCTCAACTGGTTCAAGTGTACCCGGCACCG GAT

CAGCTATAAGACCGCGTATAGGCGCGGCCTCCGGACCATGTACCGGCGGAGGTCCCAATGCTGCCCTGGCTACTATGAGAACGGAGACTTCTGCATTC G

CTGTGACAGCGAGCACTGGGGTCCCCACTGCAGCAACCGGTGTCAGTGTCAGAACGGCGCCCTGTGCAACCCTATCACCGGCGCCTGCGTGTGCGCCCCG

GGCTTCCGAGGCTGGCGCTGTGAGGAACTCTGCGCTCCTGGTACTCACGGCAAGGGCTGCCAGCTGCTCTGTCAGTGCCACCATGGCGCCAGCTGTGACC

CGCGCACTGGCGAGTGCCTCTGCGCTCCTGGCTACACAGGCGTTTA CTGTGAGGAGCTGTGCCCCCCTGGGAGCCATGGAGCTCACTGTGAGCTGCGCT

GCCCCTGCCAGAATGGAGGCACCTGCCACCACATCACTGGCGAATGTGCCTGCCCTCCAGGCTGGACG GGAGCAGTGTGTGCCCAGCCCTGCCCTCCAG

GGACCTTTGGCCAGAACTGTAGCCAGGACTGTCCCTGCCACCATGGAGGCCAGTGTGACCATGTGACTGGACAATGCCACTGTACAGCTGGATACATGGG

GGACAG GTGTCAAGAAGAATGTCCCTTTGGAACGTTCGGTTTCCTGTGCTCTCAACGCTGTGACTGCCACAATGGAGGTCAATGTTCACCAGCCACAGG

GGCCTGTGAGTGTGAGCCTGGCTACAAGGGCCCTAGCTGCCAGGAGCGGCTATGCCCTGAGGGCCTGCATGGCCCAGGCTGCACCTTGCCCTGCCCCTGT

GACACCGAGAACACTATCAG CTGCCATCCAGTTACTGGAGCTTGTACCTGCCAACCAGGCTGGTCTGGCCACTACTGCAATGAGTCCTGCCCCGCCGGC

TACTATGGCAACGGTTGCCAGCTACCCTGCACCTGCCAGAACGGTGCTGACTGCCACAGTATCACCGGGAGCTGCACTTGTGCTCCAGGCTTCATG GGA

GAGGTGTGTGCCGTCCCCTGTGCTGCAGGGACCTATGGTCCCAACTGTTCATCTGTATGTAGCTGTAGCAACGGCGGCACCTGTTCCCCAGTGGATGGCT

CCTGCACCTGCCGAGAGG GATGGCAGGGCCTGGACTGCTCCCTGCCTTGTCCCAGTGGGACCTGGGGCCTGAACTGCAATGAGACTTGCATCTGTGCCA

ATGGAGCTGCCTGCAGCCCCTTTGATGGGTCCTGTGCCTGCACCCCAGGCTGGCTGGGGGACTCCTGTGAACTGCCCTGCCCG GACGGCACTTTTGGGC

TGAACTGCAGTGAGCATTGCGACTGCAGCCATGCTGATGGCTGTGACCCTGTCACAGGCCACTGCTGCTGCCTGGCAGGATGGACAG GCATCCGCTGTG

ATAGCACGTGTCCTCCAGGTCGCTGGGGCCCCAACTGTTCAGTGTCCTGCAGCTGTGAGAACGGAGGTTCCTGCTCCCCGGAGGACGGGAGCTGCGAGTG

TGCCCCTGGCTTTCGAGGACCCTTATGTCAGAGAA TCTGCCCACCAGGATTCTACGGCCATGGCTGCGCCCAGCCTTGTCCCCTCTGCGTGCACAGCAG

GGGGCCCTGCCACCACATCAGTGGTATCTGTGAGTGCCTGCCAGGATTCTCTGGAGCCTTGTGCAACCAAG TGTGTGCTGGAGGGCACTTCGGGCAGGA

CTGTGCCCAGCTCTGTTCCTGTGCCAACAATGGGACCTGCAGCCCCATCGATGGCTCCTGTCAGTGCTTCCCTGGGTGGATTGGCAAGGACTGCTCACAG

G GTTGCCCTTCAGCATTTTTTGGGAAGGACTGTGGGCACATATGCCAGTGTCAGAATGGAGCCAGCTGTGACCACATCACTGGGAAATGCACCTGTCGA

ACAGGCTTCTCTGGCCGCCACTGTGAACAGA GATGTGCCCCTGGAACCTTTGGATATGGGTGTCAGCAGCTATGTGAGTGCATGAACAATGCCACTTGT

GACCACGTCACTGGTACCTGTTACTGTAGCCCGGGATTCAAAGGAATCAGGTGTGACCAAG CTGCCCTCATGATGGATGAGCTGAATCCCTACACCAAG

ATCAGTCCAGCTCTGGGAGCAGAGCGGCACTCAGTGGGTGCTGTCACCGGCATCGTTCTCCTGTTGTTCCTGGTGGTGGTGCTGCTGGGCCTGTTTGCCT

GGCGACGGAGGCGGCAGAAAGAGAAAGGCCGTGACCTGGCTCCCCGAGTCTCCTACACCCCAGCCATGAGGATGACCAGCACAGACTACTCTCTCTCAG 

ATTTGTCTCAAAGTAGCAGCCATGCCCAGTGCTTTTCCAATGCCAGCTACCACACACTGGCGTGTGGGGGGCCTGCCACCAGCCAGGCCAGCACTCTGGA

CAGGAACAGCCCCACCAAG CTCAGTAACAAGTCCCTTGACAGAGACACAGCAGGCTGGACCCCCTACAGCTATGTGAACGTGTTAG ACTCCCATTTCC

AGATCAGTGCCCTGGAGGCCAGGTACCCGCCCGAGGACTTCTACATTGAACTTAGACACCTCAGCCGCCATGCTGAGCCACACTCACCAG GCACTTGTG

GAATGGACAGACGTCAGAACACATACATTATGGACAAAGGCTTCAAAG TTGCACCTGCTTAGCAAACGCTTGTGGGTTTGTTATAGATGCCAGCTAAAT

GTCTTCAGAAATGTAGATCATCATTATCCAACCAATTAGTATGAGTTAAACTGATTATAAATCTGAAATAAAATCAATCTGCCTGCCCCAGAGGCCTTCT

GTCATTGTACTGACAAGGAAAACTACCCTGCACCTGCTGCCTTTCTGGGGCACAAGAAATGCAAATGATACCCAGTGTTAATACTGTATGGCCCTCACCC

TCAAGAGATCTCTGCGCCCAAGAGCAGGGAAGCCAAGACAGATGTCTACGCCACAGGAACTACATACAAGGTGGACCATTCCTCTAGGAAGTCTACAGGT

GAAGCCAAAAAGCAAGCACCAAGTCCAGCCCCTGGATTAGGCCCTAGGTTTAAATGCTGGGACACGTGAGCTAGGCAGGGAGCTCTGGAACTCTGTCACT

TATTAACTCTGTGCTTCCTAAGGTTGTTTCTTCATCTGCAAGGTTGGGATAATTATGCCTGTTGACTCATGCCTGTCTTATTATCTAACAAGGTTATCTT

GGGTGTCCAATAAAGTCGGATGGGAAGTGCTTTTGTATATT
Translation
 - UNI25306 - - UNI29674 - MAPSAVGLLVFLLQAALALNPEDPNVCSHWES - UNI19628 - - UNI25306 - SYAVTVQESYAHPF

DQIYYTRCADILNWFKCTRHR RISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIR RCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCE

ELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVY YCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWT GAVCAQPCPPGTFGQN

CSQDCPCHHGGQCDHVTGQCHCTAGYMGDR RCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTEN

TIS SCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFM GEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSC

TCREG GWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCP DGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTG GI

RCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRI ICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQV VCAG

GHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQG GCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQR RCAPGTFGYGCQQL

CECMNNATCDHVTGTCYCSPGFKGIRCDQA AALMMDELNPYTKISPALGAERHSVGAVTGIVLLLFLVVVLLGLFAWRRRRQKEKGRDLAPRVSYTPAM

RMTSTDYSLSD DLSQSSSHAQCFSNASYHTLACGGPATSQASTLDRNSPTK LSNKSLDRDTAGWTPYSYVNVLD DSHFQISALEARYPPEDFYIELR

HLSRHAEPHSPG GTCGMDRRQNTYIMDKGFKV VAPA
Transcript ENSMUST00000068967
Sequence
CGTTCTCAGTGCCCGGAGCCGGCTGCCCGGCTCGGGGCGGTTCGCAGCTCCCTCTCCTGCCTGGGGACCTGAAGCCGCTCCGGCTCCGGGGTATAGGACC

GCGCGACTGGCTGGCCCAAGCCCGGGGCGCGCCACGGAAGCAG - UNI25306 - - UNI29674 - GCCCCGATGGCGCCGTCTGCGGTGGGCCTC

CTTGTCTTCCTTCTGCAAGCTGCTCTTGCTCTGAACCCTGAAGACCCCAATGTGTGTAGCCACTGGGAGAG - UNI19628 - - UNI25306 - CT

ATGCCGTGACTGTGCAGGAGTCTTATGCACACCCCTTTGATCAGATCTACTACACACGATGTGCAGACATCCTCAACTGGTTCAAGTGTACCCGGCACCG

 GATCAGCTATAAGACCGCGTATAGGCGCGGCCTCCGGACCATGTACCGGCGGAGGTCCCAATGCTGCCCTGGCTACTATGAGAACGGAGACTTCTGCAT

TC CTCTGTGTACCGAGGAGTGCATGCACGGCCGCTGTGTCTCTCCCGATACCTGCCACTGTGAGCCTGGATGGGGAGGCCCTGACTGCTCCAGCG GCT

GTGACAGCGAGCACTGGGGTCCCCACTGCAGCAACCGGTGTCAGTGTCAGAACGGCGCCCTGTGCAACCCTATCACCGGCGCCTGCGTGTGCGCCCCGGG

CTTCCGAGGCTGGCGCTGTGAGGAACTCTGCGCTCCTGGTACTCACGGCAAGGGCTGCCAGCTGCTCTGTCAGTGCCACCATGGCGCCAGCTGTGACCCG

CGCACTGGCGAGTGCCTCTGCGCTCCTGGCTACACAGGCGTTTA CTGTGAGGAGCTGTGCCCCCCTGGGAGCCATGGAGCTCACTGTGAGCTGCGCTGC

CCCTGCCAGAATGGAGGCACCTGCCACCACATCACTGGCGAATGTGCCTGCCCTCCAGGCTGGACG GGAGCAGTGTGTGCCCAGCCCTGCCCTCCAGGG

ACCTTTGGCCAGAACTGTAGCCAGGACTGTCCCTGCCACCATGGAGGCCAGTGTGACCATGTGACTGGACAATGCCACTGTACAGCTGGATACATGGGGG

ACAG GTGTCAAGAAGAATGTCCCTTTGGAACGTTCGGTTTCCTGTGCTCTCAACGCTGTGACTGCCACAATGGAGGTCAATGTTCACCAGCCACAGGGG

CCTGTGAGTGTGAGCCTGGCTACAAGGGCCCTAGCTGCCAGGAGCGGCTATGCCCTGAGGGCCTGCATGGCCCAGGCTGCACCTTGCCCTGCCCCTGTGA

CACCGAGAACACTATCAG CTGCCATCCAGTTACTGGAGCTTGTACCTGCCAACCAGGCTGGTCTGGCCACTACTGCAATGAGTCCTGCCCCGCCGGCTA

CTATGGCAACGGTTGCCAGCTACCCTGCACCTGCCAGAACGGTGCTGACTGCCACAGTATCACCGGGAGCTGCACTTGTGCTCCAGGCTTCATG GGAGA

GGTGTGTGCCGTCCCCTGTGCTGCAGGGACCTATGGTCCCAACTGTTCATCTGTATGTAGCTGTAGCAACGGCGGCACCTGTTCCCCAGTGGATGGCTCC

TGCACCTGCCGAGAGG GATGGCAGGGCCTGGACTGCTCCCTGCCTTGTCCCAGTGGGACCTGGGGCCTGAACTGCAATGAGACTTGCATCTGTGCCAAT

GGAGCTGCCTGCAGCCCCTTTGATGGGTCCTGTGCCTGCACCCCAGGCTGGCTGGGGGACTCCTGTGAACTGCCCTGCCCG GACGGCACTTTTGGGCTG

AACTGCAGTGAGCATTGCGACTGCAGCCATGCTGATGGCTGTGACCCTGTCACAGGCCACTGCTGCTGCCTGGCAGGATGGACAG GCATCCGCTGTGAT

AGCACGTGTCCTCCAGGTCGCTGGGGCCCCAACTGTTCAGTGTCCTGCAGCTGTGAGAACGGAGGTTCCTGCTCCCCGGAGGACGGGAGCTGCGAGTGTG

CCCCTGGCTTTCGAGGACCCTTATGTCAGAGAA TCTGCCCACCAGGATTCTACGGCCATGGCTGCGCCCAGCCTTGTCCCCTCTGCGTGCACAGCAGGG

GGCCCTGCCACCACATCAGTGGTATCTGTGAGTGCCTGCCAGGATTCTCTGGAGCCTTGTGCAACCAAG TGTGTGCTGGAGGGCACTTCGGGCAGGACT

GTGCCCAGCTCTGTTCCTGTGCCAACAATGGGACCTGCAGCCCCATCGATGGCTCCTGTCAGTGCTTCCCTGGGTGGATTGGCAAGGACTGCTCACAGG 

CCTGCCCATCTGGGTTCTGGGGCTCTGCCTGCTTCCACACATGCAGCTGCCACAACGGGGCGAGCTGCAGCGCCGAGGATGGGGCCTGCCACTGCACCCC

TGGCTGGACTGGACTCTTCTGCACGCAGC GTTGCCCTTCAGCATTTTTTGGGAAGGACTGTGGGCACATATGCCAGTGTCAGAATGGAGCCAGCTGTGA

CCACATCACTGGGAAATGCACCTGTCGAACAGGCTTCTCTGGCCGCCACTGTGAACAGA GATGTGCCCCTGGAACCTTTGGATATGGGTGTCAGCAGCT

ATGTGAGTGCATGAACAATGCCACTTGTGACCACGTCACTGGTACCTGTTACTGTAGCCCGGGATTCAAAGGAATCAGGTGTGACCAAG CTGCCCTCAT

GATGGATGAGCTGAATCCCTACACCAAGATCAGTCCAGCTCTGGGAGCAGAGCGGCACTCAGTGGGTGCTGTCACCGGCATCGTTCTCCTGTTGTTCCTG

GTGGTGGTGCTGCTGGGCCTGTTTGCCTGGCGACGGAGGCGGCAGAAAGAGAAAGGCCGTGACCTGGCTCCCCGAGTCTCCTACACCCCAGCCATGAGGA

TGACCAGCACAGACTACTCTCTCTCAG ATTTGTCTCAAAGTAGCAGCCATGCCCAGTGCTTTTCCAATGCCAGCTACCACACACTGGCGTGTGGGGGGC

CTGCCACCAGCCAGGCCAGCACTCTGGACAGGAACAGCCCCACCAAG CTCAGTAACAAGTCCCTTGACAGAGACACAGCAGGCTGGACCCCCTACAGCT

ATGTGAACGTGTTAG ACTCCCATTTCCAGATCAGTGCCCTGGAGGCCAGGTACCCGCCCGAGGACTTCTACATTGAACTTAGACACCTCAGCCGCCATG

CTGAGCCACACTCACCAG GCACTTGTGGAATGGACAGACGTCAGAACACATACATTATGGACAAAGGCTTCAAAG ATTACATGAAAGAATCTGTGTGC

AGTTCTAGCACTTGCTCCTTGAACAGCAGTGAAAACCCTTACGCCACAATTAAGGACCCACCCATCCTCACCTGCAAGCTTCCAGAAAGCAGTTATGTAG

AAATGAAGTCACCTGTGCACTTGGGGTCTCCGTACACAGATGTGCCATCCTTGTCGACATCTAATAAAAATATATATGAAGTTGGTAGGTGTCTCACATA

ACTTAGCAAAACCAGGGCAACAGTGCAGCATCTCAAGTGAAAACAAGCCCTCCTCCACACACTCTATCTCCATACCACATCCTTCTGTTTGGTTGCATTT

GAAGGAACCTGAGGAGAAACTTTGTCTCAGGGTTGCCCTTCCCTCTAATGCAGGAAACCAGAATCTTGTGCCACCTTGCTTACAAATCACAACTGATAAA

AGTAGAAACTGTGAGGGTGGAGAGCCAGTATACAACACTTCGACTACTGTTAATACAAATCCAAAGCGGAAAACGAAAACAATCAGAATGGCCGTTTACA

AGTTTCTAAATCACTTCTTAAACCTCCCCCAGTAAGACCCACACCTCTAGGATGTCTTGAATCTCTTGTTGTTGAGCAAACTAGGATTCTGGCAGTACAC

TGTCTTAGGTTTTTCCCTCTCTTAAGCAAGCCTCCATCCTAATCCTCCTGGATTTGTCAGATGTATACATATACCCACAGTTTTTCTCCCCAACAAGTTA

AATAGAACTTTCTTCCCTCCCACCAAGGCAACAATGCTAATCTATTCTCTGAACTCATTTTTCACTATATTCCTTAGAGCCCACAGTCAGTGTGGTCCAA

GAAGGCCGAGGTCATAACTCCAGCTATATCCAGAATCCATACGACCTACCTAAGAACAGCCATATTCCTGGTCACTATGACCTCCTCCCAGTAAGACAGA

GCCCTGCCCATGGGCCCTTCCAGGAAAAGCAGTAAGAGGGATAAGCGTCTCTCTTAGTGTGCTCTGCTGACTATTTTCTGACTCTGAAAGAAGACAATCC

ATGACTTGAAATATCAGTACAGAATGCCTTGAGCTGTGTGTTATTAGTTCCTTCACCTGGATTGAAAGAAACACTTCCAAACGGGACTGGGGTAACTGTT

CAAGAAAGTCTGTTCACAAAGGCAAATCCTATCAACCTTTCAGCTCTAAATGTCCTGGATATGATTTTTCAGAACATTAAAGATACCACTTTTCATCAGC

ATCAGCTAAAAGCTATGTATTTAATATTCTGAAACATCGCTTAAGAAGCATGTAGCTTAGGTTCCTCAAGCCTTCCAAGAAGGAAAAGGAAACTGGGAGG

GGAGGGGGCACTTAAAGTGCCTGAAATGTGTATGTGCTGTTGATTGTTGTTATCCTCAACATCTGTTTCAGTATCTAAGGGAATTGGTATGTGGGCATGA

ACTGTTCTAATATTAATCTTGGTCTCTGTTCATTTGGTATGCCCCAGCAAATTATAACAGCCACAATCAGAGTTTAAAATATAACCTAATTCTTTAATCA

AGACAGGTTCACTTTCTTCTGCCCTATCAGTAATAGTAGGCAAAACAGAAAGGGGGAAAAGAGCAGCAGTTTCACTCACTCTAGAATGATTTCTATGCCA

GCCTTACCAAATTTTGCCAAGTCAAAGTTCAAGAATAACGAATGCCAATCCTGGCCTGGCTGCATTGCATTGGTTCACCCAATACTTGAGTCATTCTGTG

TGCACCAGAGAACTAAGATGCTGTTTTAAGAAAATGGTCACAGGGCTGGGAATGTAGCTTAGTGGTAGATGTTCTTGCCTACTGAGCAAGGACCTGGGAT

AGATCAGCAGCATCATATAAAAGGCATAGGCTTATAATGAAGTTTCCCCAACAACATAATTAGATCACTCAAGTTACTTAGTCGGAGTTCCTTGACTTGT

TTATGGGCAGTTCTTCATAGATGGTGCTTGATGTAGTATGGAACCTTAAGGTGTAGAAAATATTACACAAATGTGGGCATGGCACACTTATGTTGCTTAG

CATACATTATGTTTTTGATGCAACTAAATGAAATAAATGTAAAACAAAACAAAAACAAAAAAACATAAAAGCCCACCGCCTGAAGTGGGCAAATATGTAT

TCCATTAGTTGGTGCTTTTAATCTCCTGTCCAGAGAAGTCCATAACTTCCACTGCACAGGTAACAATAGGTAAACGGAGGCTTGGACAACTCTGAATGGT

TAATCCCCAAATTCTTCACAAGAATTAAGAACAGAAGGGACAAGTTGGAAGTTAATGGTCACCTTTGTGCCATCCCATGTTCTTAAGAGGATTAAGAGTC

TAGAGTGAGTAAAAATTACCTAGAAGGGGTTTACAGAAGAGGGACTAGAAGACTGTAAAGCTAGATACTGCTACAGGAAGTAGGGATGATAACCTTAGTT

TGAGTAGTAATCAGCAAAAGAGAGAAAATAAATATGTAAGCAAATCTCTGCTCGTTTCACTCCAGGCATAAGCCAGTATGACATTAGAGGAACACATACA

TGAATGCTGCATGTGTGCATGGAAGCGAGCCATCAGCAATAGTGAACGCTCCCAAAAGCCTTATAAAATAGAAACAGTAGGAAATATTGGTAGACCTAAG

TTAATATTTCTCATACATGTATAAAGAAACGTAGTGAAGAGACTCACCTCAGTGTTTCAGGGCCACAAGTGCTCTGTTATCTTTGTGAAGCAAGGATGAA

GAAGCATGGCGAAGTCCAACCAGCAAGCAGAAATGGCGTCTCAATCCCAGGCTTTATCTTCTTCCCCTACCCTGCATGTACAATAACTGCTACCTGGCAA

ACTGCAATCATGCAAATTCCAAACCTCACTTCTCTCTTGCCAACTACACTCTGCACAAAGTACCCAGCAAGAGGTGGGATGGCTAGAGCAGCAAGTCAAG

AGAAGTTGGCACCACTCTTGTTGAGTCACTTGCCCTCTTCGGGCTCCTTTATTACCCACACATGAAAGAAGAGAGACACAGAGTGGGAGCAGAGCTCTAA

CAACTCTCCAAGTGTAGCACTCTACAACATTTCAAGTAACATAGTTCAGTCAGGCTATACAGAGAAGGGAAAGGGCAAAGATGTGATTAAGTATGGTGAC

AGCAGCAGCCTTCACATAGCTAAGAGTTAGCACTAGGACATTTCGATCATGCAGAGCAACTGTTAGGAACTTCTGTCTAACAATCACAAACAGGTTTGCG

GTCAGCCTCAACATGTGCGCTGTGCATTCTATAGTCAATTTGGAAAGATCTGCTCAATTATTTTTCAAAACAAAAATTTCAATCCAGTAAATTAATATGT

ATACAAGTCAGACAAAGAAAACACAGATACTGTACAATAGTGTGAGAGACTATGAAATGGCAATACTTTTTTAAACCACAGATTTGTAATATATTTGTTC

ACTGTGCAGAGGATGTACCTTATACAAAATAAAATGGATTCTCAAACTAACATTAC
Translation
 - UNI25306 - - UNI29674 - MAPSAVGLLVFLLQAALALNPEDPNVCSHWES - UNI19628 - - UNI25306 - SYAVTVQESYAHPF

DQIYYTRCADILNWFKCTRHR RISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIP PLCTEECMHGRCVSPDTCHCEPGWGGPDCSSG GCDSEHWGP

HCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVY YCEELCPPGSHGAHCELRCPCQNGG

TCHHITGECACPPGWT GAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR RCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACEC

EPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTIS SCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFM GEV

CAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREG GWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCP DGTFG

LNCSEHCDCSHADGCDPVTGHCCCLAGWTG GIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRI ICPPGFYGHGCAQPCPLC

VHSRGPCHHISGICECLPGFSGALCNQV VCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQA ACPSGFWGSACFHTCSCHNGASCSAE

DGACHCTPGWTGLFCTQR RCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQR RCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGF

KGIRCDQA AALMMDELNPYTKISPALGAERHSVGAVTGIVLLLFLVVVLLGLFAWRRRRQKEKGRDLAPRVSYTPAMRMTSTDYSLSD DLSQSSSHAQ

CFSNASYHTLACGGPATSQASTLDRNSPTK LSNKSLDRDTAGWTPYSYVNVLD DSHFQISALEARYPPEDFYIELRHLSRHAEPHSPG GTCGMDRRQ

NTYIMDKGFKD DYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPESSYVEMKSPVHLGSPYTDVPSLSTSNKNIYEVGRCLT
Transcript ENSMUST00000118485
Sequence
AGGGGGGTGGGGGCTGCCGTGGCAGCAGTCGCAGCGGCTCCAGCCTCCTGCTTGCTCACTCGTTCTCAGTGCCCGGAGCCGGCTGCCCGGCTCGGGGCGG

TTCGCAGCTCCCTCTCCTGCCTGGGGACCTGAAGCCGCTCCGGCTCCGGGGTATAGGACCGCGCGACTGGCTGGCCCAAGCCCGGGGCGCGCCACGGAAG

CAG - UNI25306 - - UNI29674 - GCCCCGATGGCGCCGTCTGCGGTGGGCCTCCTTGTCTTCCTTCTGCAAGCTGCTCTTGCTCTGAACCCTG

AAGACCCCAATGTGTGTAGCCACTGGGAGAG - UNI19628 - - UNI25306 - CTATGCCGTGACTGTGCAGGAGTCTTATGCACACCCCTTTGA

TCAGATCTACTACACACGATGTGCAGACATCCTCAACTGGTTCAAGTGTACCCGGCACCG GATCAGCTATAAGACCGCGTATAGGCGCGGCCTCCGGAC

CATGTACCGGCGGAGGTCCCAATGCTGCCCTGGCTACTATGAGAACGGAGACTTCTGCATTC CTCTGTGTACCGAGGAGTGCATGCACGGCCGCTGTGT

CTCTCCCGATACCTGCCACTGTGAGCCTGGATGGGGAGGCCCTGACTGCTCCAGCG GCTGTGACAGCGAGCACTGGGGTCCCCACTGCAGCAACCGGTG

TCAGTGTCAGAACGGCGCCCTGTGCAACCCTATCACCGGCGCCTGCGTGTGCGCCCCGGGCTTCCGAGGCTGGCGCTGTGAGGAACTCTGCGCTCCTGGT

ACTCACGGCAAGGGCTGCCAGCTGCTCTGTCAGTGCCACCATGGCGCCAGCTGTGACCCGCGCACTGGCGAGTGCCTCTGCGCTCCTGGCTACACAGGCG

TTTA CTGTGAGGAGCTGTGCCCCCCTGGGAGCCATGGAGCTCACTGTGAGCTGCGCTGCCCCTGCCAGAATGGAGGCACCTGCCACCACATCACTGGCG

AATGTGCCTGCCCTCCAGGCTGGACG GGAGCAGTGTGTGCCCAGCCCTGCCCTCCAGGGACCTTTGGCCAGAACTGTAGCCAGGACTGTCCCTGCCACC

ATGGAGGCCAGTGTGACCATGTGACTGGACAATGCCACTGTACAGCTGGATACATGGGGGACAG GTGTCAAGAAGAATGTCCCTTTGGAACGTTCGGTT

TCCTGTGCTCTCAACGCTGTGACTGCCACAATGGAGGTCAATGTTCACCAGCCACAGGGGCCTGTGAGTGTGAGCCTGGCTACAAGGGCCCTAGCTGCCA

GGAGCGGCTATGCCCTGAGGGCCTGCATGGCCCAGGCTGCACCTTGCCCTGCCCCTGTGACACCGAGAACACTATCAG CTGCCATCCAGTTACTGGAGC

TTGTACCTGCCAACCAGGCTGGTCTGGCCACTACTGCAATGAGTCCTGCCCCGCCGGCTACTATGGCAACGGTTGCCAGCTACCCTGCACCTGCCAGAAC

GGTGCTGACTGCCACAGTATCACCGGGAGCTGCACTTGTGCTCCAGGCTTCATG GGAGAGGTGTGTGCCGTCCCCTGTGCTGCAGGGACCTATGGTCCC

AACTGTTCATCTGTATGTAGCTGTAGCAACGGCGGCACCTGTTCCCCAGTGGATGGCTCCTGCACCTGCCGAGAGG GATGGCAGGGCCTGGACTGCTCC

CTGCCTTGTCCCAGTGGGACCTGGGGCCTGAACTGCAATGAGACTTGCATCTGTGCCAATGGAGCTGCCTGCAGCCCCTTTGATGGGTCCTGTGCCTGCA

CCCCAGGCTGGCTGGGGGACTCCTGTGAACTGCCCTGCCCG GACGGCACTTTTGGGCTGAACTGCAGTGAGCATTGCGACTGCAGCCATGCTGATGGCT

GTGACCCTGTCACAGGCCACTGCTGCTGCCTGGCAGGATGGACAG GCATCCGCTGTGATAGCACGTGTCCTCCAGGTCGCTGGGGCCCCAACTGTTCAG

TGTCCTGCAGCTGTGAGAACGGAGGTTCCTGCTCCCCGGAGGACGGGAGCTGCGAGTGTGCCCCTGGCTTTCGAGGACCCTTATGTCAGAGAA TCTGCC

CACCAGGATTCTACGGCCATGGCTGCGCCCAGCCTTGTCCCCTCTGCGTGCACAGCAGGGGGCCCTGCCACCACATCAGTGGTATCTGTGAGTGCCTGCC

AGGATTCTCTGGAGCCTTGTGCAACCAAG TGTGTGCTGGAGGGCACTTCGGGCAGGACTGTGCCCAGCTCTGTTCCTGTGCCAACAATGGGACCTGCAG

CCCCATCGATGGCTCCTGTCAGTGCTTCCCTGGGTGGATTGGCAAGGACTGCTCACAGG CCTGCCCATCTGGGTTCTGGGGCTCTGCCTGCTTCCACAC

ATGCAGCTGCCACAACGGGGCGAGCTGCAGCGCCGAGGATGGGGCCTGCCACTGCACCCCTGGCTGGACTGGACTCTTCTGCACGCAGC GTTGCCCTTC

AGCATTTTTTGGGAAGGACTGTGGGCACATATGCCAGTGTCAGAATGGAGCCAGCTGTGACCACATCACTGGGAAATGCACCTGTCGAACAGGCTTCTCT

GGCCGCCACTGTGAACAGA GATGTGCCCCTGGAACCTTTGGATATGGGTGTCAGCAGCTATGTGAGTGCATGAACAATGCCACTTGTGACCACGTCACT

GGTACCTGTTACTGTAGCCCGGGATTCAAAGGAATCAGGTGTGACCAAG CTGCCCTCATGATGGATGAGCTGAATCCCTACACCAAGATCAGTCCAGCT

CTGGGAGCAGAGCGGCACTCAGTGGGTGCTGTCACCGGCATCGTTCTCCTGTTGTTCCTGGTGGTGGTGCTGCTGGGCCTGTTTGCCTGGCGACGGAGGC

GGCAGAAAGAGAAAGGCCGTGACCTGGCTCCCCGAGTCTCCTACACCCCAGCCATGAGGATGACCAGCACAGACTACTCTCTCTCAG GCACTTGTGGAA

TGGACAGACGTCAGAACACATACATTATGGACAAAGGCTTCAAAG ATTACATGAAAGAATCTGTGTGCAGTTCTAGCACTTGCTCCTTGAACAGCAGTG

AAAACCCTTACGCCACAATTAAGGACCCACCCATCCTCACCTGCAAGCTTCCAGAAAGCAGTTATGTAGAAATGAAGTCACCTGTGCACTTGGGGTCTCC

GTACACAGATGTGCCATCCTTGTCGACATCTAATAAAAATATATATGAAGTTG AGCCCACAGTCAGTGTGGTCCAAGAAGGCCGAGGTCATAACTCCAG

CTATATCCAGAATCCATACGACCTACCTAAGAACAGCCATATTCCTGGTCACTATGACCTCCTCCCAGTAAGACAGAGCCCTGCCCATGGGCCCTTCCAG

GAAAAGCAGTAAGAGGGATAAGCGTCTCTCTTAGTGTGCTCTGCTGACTATTTTCTGACTCTGAAAGAAGACAATCCATGACTTGAAATATCAGTACAGA

ATGCCTTGAGCTGTGTGTTATTAGTTCCTTCACCTGGATTGAAAGAAACACTTCCAAACGGGACTGGGGTAACTGTTCAAGAAAGTCTGTTCACAAAGGC

AAATCCTATCAACCTTTCAGCTCTAAATGTCCTGGATATGATTTTTCAGAACATTAAAGATACCACTTTTCATCAGCATCAGCTAAAAGCTATGTATTTA

ATATTCTGAAACATCGCTTAAGAAGCATGTAGCTTAGGTTCCTCAAGCCTTCCAAGAAGGAAAAGGAAACTGGGAGGGGAGGGGGCACTTAAAGTGCCTG

AAATGTGTATGTGCTGTTGATTGTTGTTATCCTCAACATCTGTTTCAGTATCTAAGGGAATTGGTATGTGGGCATGAACTGTTCTAATATTAATCTTGGT

CTCTGTTCATTTGGTATGCCCCAGCAAATTATAACAGCCACAATCAGAGTTTAAAATATAACCTAATTCTTTAATCAAGACAGGTTCACTTTCTTCTGCC

CTATCAGTAATAGTAGGC
Translation
 - UNI25306 - - UNI29674 - MAPSAVGLLVFLLQAALALNPEDPNVCSHWES - UNI19628 - - UNI25306 - SYAVTVQESYAHPF

DQIYYTRCADILNWFKCTRHR RISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIP PLCTEECMHGRCVSPDTCHCEPGWGGPDCSSG GCDSEHWGP

HCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVY YCEELCPPGSHGAHCELRCPCQNGG

TCHHITGECACPPGWT GAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR RCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACEC

EPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTIS SCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFM GEV

CAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREG GWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCP DGTFG

LNCSEHCDCSHADGCDPVTGHCCCLAGWTG GIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRI ICPPGFYGHGCAQPCPLC

VHSRGPCHHISGICECLPGFSGALCNQV VCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQA ACPSGFWGSACFHTCSCHNGASCSAE

DGACHCTPGWTGLFCTQR RCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQR RCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGF

KGIRCDQA AALMMDELNPYTKISPALGAERHSVGAVTGIVLLLFLVVVLLGLFAWRRRRQKEKGRDLAPRVSYTPAMRMTSTDYSLSG GTCGMDRRQN

TYIMDKGFKD DYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPESSYVEMKSPVHLGSPYTDVPSLSTSNKNIYEVE EPTVSVVQEGRGHNSSYI

QNPYDLPKNSHIPGHYDLLPVRQSPAHGPFQEKQ

For any suggestions or comments, please send an email to unitrap@crg.es