Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036473 (Tbc1d24)
Chromosomal location
Chr 17: 24312377 - 24342505 (-)
Description
TBC1 domain family, member 24 Gene [Source:MGI Symbol;Acc:MGI:2443456]
RefSeq_dna
NM_173186 
RefSeq_peptide
NP_775278.2 
UniGene
Mm.301585 
MGI
MGI:2443456 
Uniprot/SWISSPROT
Q3UUG6 
Uniprot/SPTREMBL
A5D6Q7 Q8BRB6 
Human Ortholog
ENSG00000162065 (TBC1D24)
Omim not available
UniTrap UNI16274
Vector Insertion
Chr 17: 24326999 - 24342418
Public Clones (sanger) E037G05 (ggtc) E123D03 (ggtc) IST14848D1 (tigm) IST14632D7 (tigm)
IST14480H12 (tigm) IST13613B5 (tigm) IST14910E3 (tigm) IST14651F6 (tigm)
IST12841G10 (tigm) IST14157D4 (tigm) IST14329D3 (tigm) IST13613H9 (tigm)
IST14162E8 (tigm) IST10456E5 (tigm)
Private Clones OST464296 (lexicon) OST333162 (lexicon) OST292593 (lexicon) OST276694 (lexicon)
OST227233 (lexicon) OST223782 (lexicon) OST223185 (lexicon) OST221317 (lexicon)
OST81518 (lexicon) OST61278 (lexicon) OST57720 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23132
Vector Insertion
Chr 17: 24323233 - 24326888
Public Clones not available
Private Clones OST275433 (lexicon) OST209112 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040474
Sequence
GGGGCGGGGCCGCCTACGCGCGTGCGCAGAAAGTCCAGTGCGGTCCAGCGGAGAGCCGAAGGGAGAGGTGCGGTGCGGCGCGCCGAG - UNI16274 -

 TTGAACTTTCTAGATGCAAGAGAAATCAGAGTGGTGTGAATATTTACCGCAAGTCACTGAAGTGGACCCCTGTGACATTGTTGGACAGTTCTACCATCC

AGATCAGAAAG - UNI23132 - GGTGTGTGGGATGACAGACTGGTTAACAGAAAACCCCCGAAGCTGGGGCTGCAGGATTTAGCTGCTTTTTGTTCC

CTTCCTGGCAGCCTAGGACCTGCCTTGTGGGCACACTGGGCACCATGGACCCCCCAGGGTACAATTGCTTTGTGGATAAGGACAAGATGGATGCATCCAT

CCAGGACCTGGGGCCAAAGGAGCTGAACTGCACGGAGCTACAGGAGCTGAAGCAACTGGCACGGCAGGGTTACTGGGCTCAGAGCCACACCCTGCGCGGG

AAAGTGTACCAGCGCCTGATCCGGGACATCCCCTGCCGCACAGTCACACCTGATGCCAGCGTGTACAGTGACATTGTGGGGAAGATTGTGGGCAAGCACA

GCAGCAGTAGTCTGCCCTTGCCTGAGTTTGTAGACAACACTCAGGTGCCCACCTACTGCCTGAACACACGGGGTGAAGGGGCTGTGCGCAAGATCCTCCT

GTGTATTGCCAACCAGTTCCCTGACATCTCCTTCTGCCCTGCCCTGCCTGCTGTGGTGGCCTTGCTACTGCACTACAGCATCGATGAAGCTGAGTGTTTC

GAAAAAGCCTGCCGCATCTTATCCTGCAATGACCCCACCAAGAAGCTCATTGACCAGAGCTTCCTGGCCTTTGAGTCTTCCTGTATGACATTTGGGGACC

TGGTGAACAAGTACTGCCAGGCAGCCCATAAACTGATGGTGGCCGTGTCAGAGGACGTCCTGCAGGTCTACTCTGACTGGCAGCGATGGCTCTTTGGGGA

GCTGCCCCTCAATTACTTTGCCCGTGTTTTTGATGTCTTCCTTGTAGAAGGCTACAAAGTATTGTACCGAGTTGCTCTGGCCATCCTCAAGTTCTTCCAC

AAGGTGAGAGCAGGACAGCCCCTTGAGTCAGACAATGTAAAGCAAGACATCCGAATGTTTGTCAAGGACATTGCCAAGACAGTGTCCCCTGAGAAACTAC

TAGAGAAGGCCTTTGCCATCCGCCTATTTTCCCGAAAGGAGATCCAGCTCTTGCAAATGGCCAATGAGAAAGCACTGAGGCAGAAGGGTATAACTGTCAA

ACAGAAGAG GCAGTTTGTGCACTTAGCTGTCCATGCAGAGAACTTCCACTCAGAGATTGTCAGCGTGAAGGAGATGAGAGACATTTGGTCCTGGATCCC

TGAGCGCTTTGCCCTCTGCCAACCCCTCCTGCTCTTCTCATCACTGCAGCATGGGTACAGCCTAAGCAG GTTCTATTTCCAGTGTGAAGGACATGAGCC

CACCCTCCTGCTCATCAAGACCACTCAAAAGGAG GTCTGTGGGGCTTACCTGTCAACAGACTGGAGCGAGAGGACTAAATTCGGAGGCAAGCTGGGCTT

CTTTGGGACTGGAGAATGCTTTGTTTTTAGG CTGCAGCCGGAAGTGCAGCGCTATGAGTGGGTGGTCATCAAACACCCAGAGCTGACCAAGGCAACATC

CCTCAAGTCTTCAGAGGCTGCAGGCAGTTCTTCCCTCATCAGCCACTGCTCTTCAGACCCCGCTGATCGGCTCTCCCCTTTCCTGGCTGCCCGGCACTTC

AACCTGCCCTCCAAGACTGAGTCCATGTTCATGGCTGGAGGCAATGACTGCCTCATCATTG GGGGAGGAGGTGGTCAAGCACTCTACGTTGATGGGGAC

CTGAATCGAGGGCGCACTGGACACTGTGACACATTCAACAACCAGCCCCTCTGCTCTGAGAACTTCCTCATCGCAGCTGTGGAGGCTTGGGGCTTCCAAG

ACCCTGACACCGAATGACGGGCCCGCACTGATG AGCCTGAAGCTCTTGCTGCGCCTCGCTGCGAGTCCACACCTGAAGGTGGCCTCCGGAGAGACTTTC

TTTGACCACCTTGGCCAGTCAGCTCCATTTCCAGAGTTCTTCTCAGAGCTGACTAGACTCTGAGGCCTTTGCCTCTCATCCCTGTGGCCTCCTTGAAGTT

CTGTAGTCTTGGTGACTCTTGTACTTGGTTCCTCTGTCACAGTGACTGAGGCCCACCAAGCATGGCATGCTTGTCCCCATCCAGCTTTTTGCCTTCTCCC

CAGGCCCTGTGCTCCCCTGGACCCGTTCACACAGCATCTGATTCACCTGTGTGACCTGATCCCTCAGCTGGCACTGTGGCCGACCACGTACTGTATCTTC

TGTGTGCTACCCCTGCCCCTATTAAGGCCTTCAGGTCTCTGGATGTCTGTGCTTCCTGAGCCCTGTGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCA

CATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTACACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCT

GTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAAGGGAGGTGCTGCTTCTGAGGACTCTCGCAAGCTCCTCTTC

CCCGTGACCTCCCTCAGCTGGTCCTGAGGGTCTAGGCGCCACAGAGGAAGAGAGAAGAAGCAGTGGCCCAAATGGCTCTGCTGGGGCCATGGAAGTCGGG

ATCATAAGGACAGGCGCCTAGCTTCCACATGACTGTCTGGCGTGCTTGAGAGTCAGCATGTGTCAGGCCAGTGCTTGTCTCCACGCTGAGATTCACTTTC

GCTGGGGAAGGTCCATCCTTCCCTGTTCCACCAATTCACACCAGCTCTCTGCACGGCCACAGTGGCAGAAGAGGCAGGGCAGAAAGGAGCCTCATGCATC

TAGAACTCTGGATTCTGCACAGTGGACAAGTTCCCCCACCATGCTGGCTTCCAGGATGGGTTCGCGTGACTCTATAGAGTGAAGAGGAACCACTGTTGCT

CACCTCTACAGAAGGTTATAAGCCTCAATGCCCACTTCCCCTGAGCCCACTGCCGAGGCCTAGACCTCCAACTCTGGTGTTCATTTAACACCATCTTGAT

TTTTGTTTCTGGCAAGATCTTACTAGTTAACCTAACTGGCCTGGAACTCCCTATGTAGCCCAGGCTAGCCTGGAAATTGCTATGTAGCCTAGGTTAGACT

CAAAAATCATGATCTCCCTCAGCCTCCTCATTGCTGGGCTTCTAGGTGTTAGGCCCAGCTGAGCGCTTTGAGTTTGACTGCCTCCGTTCTGAGTCGGGCT

CCTGCCAGAAGGCCCCCAGGACGTTCCCAGGCTGAGCTCTTGCCGCTCACCCATGCATTACCACTGAGACTCAGAAGCCTTCAGAAGCAATGACGTTAAT

TGGGAGTATGTGCGGGGCTCTGCAGGGTTCCAGACTGGTGGTGGACCTTGTGTTCTGTGTGGCCCCCACTGGCAGTCCCAGGGGTCTAGCCCAAGGAGAC

TGATGGATGCTGAGTCATGATCACATCACAAGCAAAGTTCTTAGCTTTTCTCCCACAACATACCCAGCTCTTTAAATTTAATGTCCTTTTTTTTTCTGAC

TTTTCTACCAAAAGGTGTGTATTGTTTTCTTTATATTTTTATTCTTATCACTGTTCTTATCTGATACTACTAAGTGTTCTCACTTAGTATTTATTTTATT

AATGTTTTCTATTATTTATTAGCTTTTGATGTTAAAAAAAAACCAAGCCAAAATGTGATGGCATTGTATAAGAAGTTATATTTTAGCAGCATTCAAACAT

TTGTTTTTAAAACAAATACTTAATCCAATTTAAGCCCATTCGTTAAACTAACCAAGTTTGTTAATATATAGCATATGCCGTCGGAGCCTCAGAAGCTCAG

TTTATGATTTGCTTTGGTTTAGTTTGTGACAAGAGTGTCAGTTTCATGCAGCTCAGGCTAGCCTTGAACTAACTGTGTAGCTGAAGCTGCCCTTGGATTC

ATCTTCCTGCTTTCATCCTCTACATATTTGCATTACAGGTGTGTGTGTGTGCCACCATGCCTGGTGATAATCAGCTCATTTTTAAAGTAATTTATGATAC

AACACTAGGTGTTGGCATTTTAAGAATATATATATATGTATGCATATATGTATACATATGATATGTATATATATATGTATGCATATATGTATACATATGA

TATATATACATATATACATATACATATATATATATATTGGTTTTTGGTTTTCAAGACAGGGTTTCTCTGTGTAGCTCTGGCTATCCTGGAACAGAATCTA

TAGACTAGGCTGGCCTCTGACTCACAGATGCATCTGCCTCCTGAGTGCTGGGATTAAAGGTATGTGCCACCACCGTCCATCCTAATTTCTCTATTATTAA

ACTAAAATTACTATTTAATTTTTCCTATTTTTTATAAGCTGTCTGCTTTTATTTTCCAGTTTTTCAGTGCAGTTTGTTTTAGAGCATTCTGGATTTCAGA

TCTTTAAATGTCCTTTACCCATTTTCTGAGTTCGTAGAGGTTTTCTGATCTCTTTAAATATTTTATATTTGACAATTTAGGTTTTGTGCCCCCTCCCTTT

GAGATGCTGAGGATTGAACCTAAGACCTTATACATTCTAGGCAAGTTCTCTACCACTGAGCCATGCCCTCAGCCCTACATTTATATATTGAACTGATTTT

CAGTTTACATCAGAATTGCTGAGATGGAATTTATAGACTCTCATCCACTTGTCTACTATAAACATCAAAAAACAATTGGCCTAGTGGCAGACTCTTAATC

CCATTATTCAGAAGGTAGAGGTAGGGGGATCTCAGAGAGTTTGAGGCCATCCTGTTCTATGTAACAGGTTCCAGACCAGCCAGGGCTACATAATAAGACC

TTGTCTTAAAAATATATATGTATATGTGTATATACACATACATACATACATACATACATACATACATACATACATACATACATACATGGGCTGGGGATAA

AGAGAAGGCTCAGTAATTAGAGCACTGGGCCTTCCAGGGTACCCAAGTTCAGTTTTCAGTATCTATATGATGGCTTACAACTATCTATAACTCAGTTCCT

AGGGATCTAAGCCCTTTCTTGGCTTCTGTAGGCACTGTGCCAATGTAGAACACAGACACAGTCAAAACACTCATAAACATAAAATAAAAATGAAGGGAAA

GATAAAACAGACATTATTGTGGTGCAGTGCCCCTGACTGTACAGGAATACATGCAGTTTTACAGAGACCTGCTCTCTCATATCTTCACTAAATCTAGAAA

GTTACAGATTGTACTAGTTGTTTTGTTTTTAAGTCACTATTGAGGTTGAAGTTCTGTAGCAACTACCTCAGAGAGGGCTAGCTCCTCCATAGCTCTATTC

AGGTCTGTGTGACAAAGTTGTTATGTCAAGCATGAGTGCCAAACAGGCTTTACACTTCTTTCCCCACAGTATTTCCATCAGGCTGGAAAGCATATGAAGT

GTAAAGGATAATTTTGGTATTAAGATTCGTATCTGGGCCTGGTGTGTGTCTATAATCCCAGCACATGGACGGTAGAGGCAGAAATGTCAAATCATCTTTA

GCAACAGAACAAGTTCAAGCTAGCTATGGCTACAAGAGACCTGTCTCAATAAACAAACAAACAGACAAATAAATGGAGTCTTTTATGACTTCCCTTGTTA

CATCAATCTTTGATTGTGCTGTAGGTGTTAGATGCAGTGTCTCATGGCTACGTTGTTACAGACAAATGATACTTGTTTGAAGGCTTGGTCATTTATTGAT

CTGCATGGAAATTGTGAATACTGTATGTAGGACTAAGGAAGCAGCCAGTGGACACATGGATAGGCTAATCTGTGACATGTCAGGAACCAACCACAACAAA

AGGAAGGCATCCATTGGTGTGCTGCTTGTCTGCTCTGCAGTTGCTGCCTAGCCTATTTTCCTATGTGAAGAGACCAGAGCACCTCTGCTGTGCATTATAC

CACCACATTGGAGATGCGCTCAGGAGCTTATATGCTGAACTCGATGGCTCATAAGAGCACTGGCTGAGTGGTGCCTTAGTTCCAGTACTCAAGAGCCAAA

GGCTGGTGGGTCTCTGAGTTCAAGGTCAGCCTGGTCTACAGAGTGAGTTCCAGGATAGCTAGGGCTAAACAGAGAAACCTTGTCTCTGGGAGTAGGGTGG

GGGAGCATTGTCTGCTTGTCTGGATAATCCCGGTTTGATTTCCAACACCTAAATTGTGGTTCACAACCATCTGTTACTCCAGTTCCAGGGGATCTGACAC

CCTGTTCTGGGCTATTTGAACACTGCATGCAAGTGGTGTACAGACGTACATGCAGGCAAAACACAATAAACATAAAATTGAAATATAGGTTTAAGCCGGG

CATGGTGGCACACGCCTTTAGTCCCAGCACTCGGGAGGCAGAGGCGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGA

CAGCCAGGGCTATACAGAGAAACCCTGTCTCAAAACAACAACAACAACAAACAAAGAAGAAAGATTTAAAAAAAGTTTGTAAGCTGAAGGCCTAAGGAGA

AGTTCCAAAGCATAATTTTGCCTTTTAAACCTTGTAGTTATGGATTTTGACAAATGGCCACCAATTAGAGGAGTCACACTGCACTGTCATCTCAGCGCTC

AGGAGACTGAGGCAGGAAGATTGCAAGCATGGGGCTGGTCTGACCTAACAGGGAGTTTTAGGCTGGCCTAGCTTACATAAAGACCTTATCTTTTAAAAAA

GAAATAGGGGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTCCTCTTCCAGAGGTCCTGAGTTCAATTCCCAGCAACCACATGGTGGCTCACAAC

CATCTGTAATGAGACCTGACGCCCTCTTCTGGTGTGTCTGAAGACAGTACAGTGTACTACACTGTATACTAAATAAATAAATCTTTAAAAAAAAAAAGAA

ACAGAAAACAATGTGGTCCCCAGCTGACCATCGGAGTGTCTGGATGAGTAGCCAGCATACTCGTGCTTACAAAGCAAAAGTGTGGACTTGCAGCAATATA

CAACTTTGTGATGTGAAAATAAGTGATTTGGTTAGTGTTAGTATGTTTCCTAAATAAAGTTAGTATCTGTTGAAGAGGT
Translation
 - UNI16274 -  - UNI23132 - MDPPGYNCFVDKDKMDASIQDLGPKELNCTELQELKQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDAS

VYSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPTKKLIDQS

FLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYSDWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDNVKQDIRMF

VKDIAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEKALRQKGITVKQKR RQFVHLAVHAENFHSEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQHG

YSLSR RFYFQCEGHEPTLLLIKTTQKE VCGAYLSTDWSERTKFGGKLGFFGTGECFVFR LQPEVQRYEWVVIKHPELTKATSLKSSEAAGSSSLISH

CSSDPADRLSPFLAARHFNLPSKTESMFMAGGNDCLIIG GGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVEAWGFQDPDTE 
Transcript ENSMUST00000097376
Sequence
GGGGCGGGGCCGCCTACGCGCGTGCGCAGAAAGTCCAGTGCGGTCCAGCGGAGAGCCGAAGGGAGAGGTGCGGTGCGGCGCGCCGAG - UNI16274 -

 TTGAACTTTCTAGATGCAAGAGAAATCAGAGTGGTGTGAATATTTACCGCAAGTCACTGAAGTGGACCCCTGTGACATTGTTGGACAGTTCTACCATCC

AGATCAGAAAG - UNI23132 - GGTGTGTGGGATGACAGACTGGTTAACAGAAAACCCCCGAAGCTGGGGCTGCAGGATTTAGCTGCTTTTTGTTCC

CTTCCTGGCAGCCTAGGACCTGCCTTGTGGGCACACTGGGCACCATGGACCCCCCAGGGTACAATTGCTTTGTGGATAAGGACAAGATGGATGCATCCAT

CCAGGACCTGGGGCCAAAGGAGCTGAACTGCACGGAGCTACAGGAGCTGAAGCAACTGGCACGGCAGGGTTACTGGGCTCAGAGCCACACCCTGCGCGGG

AAAGTGTACCAGCGCCTGATCCGGGACATCCCCTGCCGCACAGTCACACCTGATGCCAGCGTGTACAGTGACATTGTGGGGAAGATTGTGGGCAAGCACA

GCAGCAGTAGTCTGCCCTTGCCTGAGTTTGTAGACAACACTCAGGTGCCCACCTACTGCCTGAACACACGGGGTGAAGGGGCTGTGCGCAAGATCCTCCT

GTGTATTGCCAACCAGTTCCCTGACATCTCCTTCTGCCCTGCCCTGCCTGCTGTGGTGGCCTTGCTACTGCACTACAGCATCGATGAAGCTGAGTGTTTC

GAAAAAGCCTGCCGCATCTTATCCTGCAATGACCCCACCAAGAAGCTCATTGACCAGAGCTTCCTGGCCTTTGAGTCTTCCTGTATGACATTTGGGGACC

TGGTGAACAAGTACTGCCAGGCAGCCCATAAACTGATGGTGGCCGTGTCAGAGGACGTCCTGCAGGTCTACTCTGACTGGCAGCGATGGCTCTTTGGGGA

GCTGCCCCTCAATTACTTTGCCCGTGTTTTTGATGTCTTCCTTGTAGAAGGCTACAAAGTATTGTACCGAGTTGCTCTGGCCATCCTCAAGTTCTTCCAC

AAGGTGAGAGCAGGACAGCCCCTTGAGTCAGACAATGTAAAGCAAGACATCCGAATGTTTGTCAAGGACATTGCCAAGACAGTGTCCCCTGAGAAACTAC

TAGAGAAGGCCTTTGCCATCCGCCTATTTTCCCGAAAGGAGATCCAGCTCTTGCAAATGGCCAATGAGAAAGCACTGAGGCAGAAGGGTATAACTGTCAA

ACAGAAGAG TGTCTCACTTTCTAAAAG GCAGTTTGTGCACTTAGCTGTCCATGCAGAGAACTTCCACTCAGAGATTGTCAGCGTGAAGGAGATGAGAG

ACATTTGGTCCTGGATCCCTGAGCGCTTTGCCCTCTGCCAACCCCTCCTGCTCTTCTCATCACTGCAGCATGGGTACAGCCTAAGCAG GTTCTATTTCC

AGTGTGAAGGACATGAGCCCACCCTCCTGCTCATCAAGACCACTCAAAAGGAG GTCTGTGGGGCTTACCTGTCAACAGACTGGAGCGAGAGGACTAAAT

TCGGAGGCAAGCTGGGCTTCTTTGGGACTGGAGAATGCTTTGTTTTTAGG CTGCAGCCGGAAGTGCAGCGCTATGAGTGGGTGGTCATCAAACACCCAG

AGCTGACCAAGGCAACATCCCTCAAGTCTTCAGAGGCTGCAGGCAGTTCTTCCCTCATCAGCCACTGCTCTTCAGACCCCGCTGATCGGCTCTCCCCTTT

CCTGGCTGCCCGGCACTTCAACCTGCCCTCCAAGACTGAGTCCATGTTCATGGCTGGAGGCAATGACTGCCTCATCATTG GGGGAGGAGGTGGTCAAGC

ACTCTACGTTGATGGGGACCTGAATCGAGGGCGCACTGGACACTGTGACACATTCAACAACCAGCCCCTCTGCTCTGAGAACTTCCTCATCGCAGCTGTG

GAGGCTTGGGGCTTCCAAGACCCTGACACCGAATGACGGGCCCGCACTGATG AGCCTGAAGCTCTTGCTGCGCCTCGCTGCGAGTCCACACCTGAAGGT

GGCCTCCGGAGAGACTTTCTTTGACCACCTTGGCCAGTCAGCTCCATTTCCAGAGTTCTTCTCAGAGCTGACTAGACTCTGAGGCCTTTGCCTCTCATCC

CTGTGGCCTCCTTGAAGTTCTGTAGTCTTGGTGACTCTTGTACTTGGTTCCTCTGTCACAGTGACTGAGGCCCACCAAGCATGGCATGCTTGTCCCCATC

CAGCTTTTTGCCTTCTCCCCAGGCCCTGTGCTCCCCTGGACCCGTTCACACAGCATCTGATTCACCTGTGTGACCTGATCCCTCAGCTGGCACTGTGGCC

GACCACGTACTGTATCTTCTGTGTGCTACCCCTGCCCCTATTAAGGCCTTCAGGTCTCTGGATGTCTGTGCTTCCTGAGCCCTGTGCCAGCCTGTGCACA

TAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTACACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGT

GCACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAGCCTGTGCACATAGGATGCCAAGGGAGGTGCTGCTTCTGAGGA

CTCTCGCAAGCTCCTCTTCCCCGTGACCTCCCTCAGCTGGTCCTGAGGGTCTAGGCGCCACAGAGGAAGAGAGAAGAAGCAGTGGCCCAAATGGCTCTGC

TGGGGCCATGGAAGTCGGGATCATAAGGACAGGCGCCTAGCTTCCACATGACTGTCTGGCGTGCTTGAGAGTCAGCATGTGTCAGGCCAGTGCTTGTCTC

CACGCTGAGATTCACTTTCGCTGGGGAAGGTCCATCCTTCCCTGTTCCACCAATTCACACCAGCTCTCTGCACGGCCACAGTGGCAGAAGAGGCAGGGCA

GAAAGGAGCCTCATGCATCTAGAACTCTGGATTCTGCACAGTGGACAAGTTCCCCCACCATGCTGGCTTCCAGGATGGGTTCGCGTGACTCTATAGAGTG

AAGAGGAACCACTGTTGCTCACCTCTACAGAAGGTTATAAGCCTCAATGCCCACTTCCCCTGAGCCCACTGCCGAGGCCTAGACCTCCAACTCTGGTGTT

CATTTAACACCATCTTGATTTTTGTTTCTGGCAAGATCTTACTAGTTAACCTAACTGGCCTGGAACTCCCTATGTAGCCCAGGCTAGCCTGGAAATTGCT

ATGTAGCCTAGGTTAGACTCAAAAATCATGATCTCCCTCAGCCTCCTCATTGCTGGGCTTCTAGGTGTTAGGCCCAGCTGAGCGCTTTGAGTTTGACTGC

CTCCGTTCTGAGTCGGGCTCCTGCCAGAAGGCCCCCAGGACGTTCCCAGGCTGAGCTCTTGCCGCTCACCCATGCATTACCACTGAGACTCAGAAGCCTT

CAGAAGCAATGACGTTAATTGGGAGTATGTGCGGGGCTCTGCAGGGTTCCAGACTGGTGGTGGACCTTGTGTTCTGTGTGGCCCCCACTGGCAGTCCCAG

GGGTCTAGCCCAAGGAGACTGATGGATGCTGAGTCATGATCACATCACAAGCAAAGTTCTTAGCTTTTCTCCCACAACATACCCAGCTCTTTAAATTTAA

TGTCCTTTTTTTTTCTGACTTTTCTACCAAAAGGTGTGTATTGTTTTCTTTATATTTTTATTCTTATCACTGTTCTTATCTGATACTACTAAGTGTTCTC

ACTTAGTATTTATTTTATTAATGTTTTCTATTATTTATTAGCTTTTGATGTTAAAAAAAAACCAAGCCAAAATGTGATGGCATTGTATAAGAAGTTATAT

TTTAGCAGCATTCAAACATTTGTTTTTAAAACAAATACTTAATCCAATTTAAGCCCATTCGTTAAACTAACCAAGTTTGTTAATATATAGCATATGCCGT

CGGAGCCTCAGAAGCTCAGTTTATGATTTGCTTTGGTTTAGTTTGTGACAAGAGTGTCAGTTTCATGCAGCTCAGGCTAGCCTTGAACTAACTGTGTAGC

TGAAGCTGCCCTTGGATTCATCTTCCTGCTTTCATCCTCTACATATTTGCATTACAGGTGTGTGTGTGTGCCACCATGCCTGGTGATAATCAGCTCATTT

TTAAAGTAATTTATGATACAACACTAGGTGTTGGCATTTTAAGAATATATATATATGTATGCATATATGTATACATATGATATGTATATATATATGTATG

CATATATGTATACATATGATATATATACATATATACATATACATATATATATATATTGGTTTTTGGTTTTCAAGACAGGGTTTCTCTGTGTAGCTCTGGC

TATCCTGGAACAGAATCTATAGACTAGGCTGGCCTCTGACTCACAGATGCATCTGCCTCCTGAGTGCTGGGATTAAAGGTATGTGCCACCACCGTCCATC

CTAATTTCTCTATTATTAAACTAAAATTACTATTTAATTTTTCCTATTTTTTATAAGCTGTCTGCTTTTATTTTCCAGTTTTTCAGTGCAGTTTGTTTTA

GAGCATTCTGGATTTCAGATCTTTAAATGTCCTTTACCCATTTTCTGAGTTCGTAGAGGTTTTCTGATCTCTTTAAATATTTTATATTTGACAATTTAGG

TTTTGTGCCCCCTCCCTTTGAGATGCTGAGGATTGAACCTAAGACCTTATACATTCTAGGCAAGTTCTCTACCACTGAGCCATGCCCTCAGCCCTACATT

TATATATTGAACTGATTTTCAGTTTACATCAGAATTGCTGAGATGGAATTTATAGACTCTCATCCACTTGTCTACTATAAACATCAAAAAACAATTGGCC

TAGTGGCAGACTCTTAATCCCATTATTCAGAAGGTAGAGGTAGGGGGATCTCAGAGAGTTTGAGGCCATCCTGTTCTATGTAACAGGTTCCAGACCAGCC

AGGGCTACATAATAAGACCTTGTCTTAAAAATATATATGTATATGTGTATATACACATACATACATACATACATACATACATACATACATACATACATAC

ATACATGGGCTGGGGATAAAGAGAAGGCTCAGTAATTAGAGCACTGGGCCTTCCAGGGTACCCAAGTTCAGTTTTCAGTATCTATATGATGGCTTACAAC

TATCTATAACTCAGTTCCTAGGGATCTAAGCCCTTTCTTGGCTTCTGTAGGCACTGTGCCAATGTAGAACACAGACACAGTCAAAACACTCATAAACATA

AAATAAAAATGAAGGGAAAGATAAAACAGACATTATTGTGGTGCAGTGCCCCTGACTGTACAGGAATACATGCAGTTTTACAGAGACCTGCTCTCTCATA

TCTTCACTAAATCTAGAAAGTTACAGATTGTACTAGTTGTTTTGTTTTTAAGTCACTATTGAGGTTGAAGTTCTGTAGCAACTACCTCAGAGAGGGCTAG

CTCCTCCATAGCTCTATTCAGGTCTGTGTGACAAAGTTGTTATGTCAAGCATGAGTGCCAAACAGGCTTTACACTTCTTTCCCCACAGTATTTCCATCAG

GCTGGAAAGCATATGAAGTGTAAAGGATAATTTTGGTATTAAGATTCGTATCTGGGCCTGGTGTGTGTCTATAATCCCAGCACATGGACGGTAGAGGCAG

AAATGTCAAATCATCTTTAGCAACAGAACAAGTTCAAGCTAGCTATGGCTACAAGAGACCTGTCTCAATAAACAAACAAACAGACAAATAAATGGAGTCT

TTTATGACTTCCCTTGTTACATCAATCTTTGATTGTGCTGTAGGTGTTAGATGCAGTGTCTCATGGCTACGTTGTTACAGACAAATGATACTTGTTTGAA

GGCTTGGTCATTTATTGATCTGCATGGAAATTGTGAATACTGTATGTAGGACTAAGGAAGCAGCCAGTGGACACATGGATAGGCTAATCTGTGACATGTC

AGGAACCAACCACAACAAAAGGAAGGCATCCATTGGTGTGCTGCTTGTCTGCTCTGCAGTTGCTGCCTAGCCTATTTTCCTATGTGAAGAGACCAGAGCA

CCTCTGCTGTGCATTATACCACCACATTGGAGATGCGCTCAGGAGCTTATATGCTGAACTCGATGGCTCATAAGAGCACTGGCTGAGTGGTGCCTTAGTT

CCAGTACTCAAGAGCCAAAGGCTGGTGGGTCTCTGAGTTCAAGGTCAGCCTGGTCTACAGAGTGAGTTCCAGGATAGCTAGGGCTAAACAGAGAAACCTT

GTCTCTGGGAGTAGGGTGGGGGAGCATTGTCTGCTTGTCTGGATAATCCCGGTTTGATTTCCAACACCTAAATTGTGGTTCACAACCATCTGTTACTCCA

GTTCCAGGGGATCTGACACCCTGTTCTGGGCTATTTGAACACTGCATGCAAGTGGTGTACAGACGTACATGCAGGCAAAACACAATAAACATAAAATTGA

AATATAGGTTTAAGCCGGGCATGGTGGCACACGCCTTTAGTCCCAGCACTCGGGAGGCAGAGGCGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTC

TACAAAGTGAGTTCCAGGACAGCCAGGGCTATACAGAGAAACCCTGTCTCAAAACAACAACAACAACAAACAAAGAAGAAAGATTTAAAAAAAGTTTGTA

AGCTGAAGGCCTAAGGAGAAGTTCCAAAGCATAATTTTGCCTTTTAAACCTTGTAGTTATGGATTTTGACAAATGGCCACCAATTAGAGGAGTCACACTG

CACTGTCATCTCAGCGCTCAGGAGACTGAGGCAGGAAGATTGCAAGCATGGGGCTGGTCTGACCTAACAGGGAGTTTTAGGCTGGCCTAGCTTACATAAA

GACCTTATCTTTTAAAAAAGAAATAGGGGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTCCTCTTCCAGAGGTCCTGAGTTCAATTCCCAGCAA

CCACATGGTGGCTCACAACCATCTGTAATGAGACCTGACGCCCTCTTCTGGTGTGTCTGAAGACAGTACAGTGTACTACACTGTATACTAAATAAATAAA

TCTTTAAAAAAAAAAAGAAACAGAAAACAATGTGGTCCCCAGCTGACCATCGGAGTGTCTGGATGAGTAGCCAGCATACTCGTGCTTACAAAGCAAAAGT

GTGGACTTGCAGCAATATACAACTTTGTGATGTGAAAATAAGTGATTTGGTTAGTGTTAGTATGTTTCCTAAATAAAGTTAGTATCTGTTGAAGAGGT
Translation
 - UNI16274 -  - UNI23132 - MDPPGYNCFVDKDKMDASIQDLGPKELNCTELQELKQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDAS

VYSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPTKKLIDQS

FLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYSDWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDNVKQDIRMF

VKDIAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEKALRQKGITVKQKS SVSLSKR RQFVHLAVHAENFHSEIVSVKEMRDIWSWIPERFALCQPLL

LFSSLQHGYSLSR RFYFQCEGHEPTLLLIKTTQKE VCGAYLSTDWSERTKFGGKLGFFGTGECFVFR LQPEVQRYEWVVIKHPELTKATSLKSSEAA

GSSSLISHCSSDPADRLSPFLAARHFNLPSKTESMFMAGGNDCLIIG GGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVEAWGFQDPDTE 


For any suggestions or comments, please send an email to unitrap@crg.es