Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036529 (Sbf1)
Chromosomal location
Chr 15: 89118667 - 89145742 (-)
Description
SET binding factor 1 Gene [Source:MGI Symbol;Acc:MGI:1925230]
RefSeq_dna
NM_001081030 
RefSeq_peptide
NP_001074499.1 
UniGene
Mm.35483 
MGI
MGI:1925230 
Uniprot/SWISSPROT
Q6ZPE2 
Uniprot/SPTREMBL
B2RXQ1 
Human Ortholog
ENSG00000100241 (SBF1)
Omim not available
UniTrap UNI36882
Vector Insertion
Chr 15: 89139002 - 89145492
Public Clones W012B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2222
Vector Insertion
Chr 15: 89132809 - 89132882
Public Clones CB0310 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109324
Sequence
GGGCAGAACTGCGCAGGCTCCTGAAGCGCCCGGGCGGGCCGGCTGGCTGGGAAGATGGCGGCGGAAGCCCTGGTCAGCGGCGCCGCAGAGGAGCGGGCCC

GGGGTGTCCCAAGTGTGCAGCTTAGGGCCAGCGCCGGGCCATGAGCGCGCCGCCATCGAACCCTCGAGCCGTGGAGCCCGCCTGCGCCCCTTGCCATGGC

GCGGCTCGCGGACTACTTCGTGCTGGTGGCGTTCGGGCCGCACCCGCGCG - UNI36882 - GGAGTGGGGAAGGCCAGGGCCAGATCCTGCAGCGCT

TCCCGGAGAAGGACTGGGAGGACAACCCTTTCCCCCAGGGCATTGAGCTG TTTTGCCAGCCCAGTGGGTGGCAGCTATGTCCCGAGAGGAATCCACCAA

CTTTCTTTGTGGCTGTCCTTACTGACATCAACTCTGAGAGGCACTACTGCGCCTGCTTGACCTTCTGGGAGCCAGTGGAGTCCACACAG GAAGTAGTGT

GCACTGACAATGCCACGGAGAAGGAGGAAGAGGCAGATGGAGGAGGCCAAGCGCGGCTGTCATCCACAGCCCCAGCCCAGCCTGGCCAGCTTTTTGCGCC

AAAGACTCTGGTTCTGGTGTCTCGACTGGACCATGCCGAAGTGTTCAGG AATAGCCTTGGTCTCATCTATGCTATCCACGTGGAAGGCCTGAATGTGAG

CCTCGAGAATGTGATCGGGAACCTGCTCACATGTACCGTCCCATTGGCTGGCGGGTCTCAG CTGGACTCTGTTGAGGAAGGAGCG AGAACCATCTCTT

TGGGGGCTGGTGACCGGCAGGTCATTCAGACTCCACTGGTAGACTCACTGCCTGTCAGCCGCTGTAGTGTAGCCCTGCTCTTCCGCCAGCTGG GTATCA

CCAATGTGCTGTCTTTGTTCTGTGCTGCCCTTACTGAGCACAAAGTCCTCTTCTTGTCCAGGAGCTACCAACGTCTAGCAGATGCTTGCAGGGGTCTCTT

GGCATTGCTGTTCCCTCTCAGATACAG CTTCACTTATGTGCCCATCTTGCCGGCACAGCTGCTGGAAGTCCTTAGCACACCTACGCCTTTCATCATTGG

GGTCAATGCAGCCTTCCAGGCAGAGACTCAGGAGCTG CTGGATGTGATTGTTGCTGATCTTGACGGAGGGACAGTGACTGTCCCTGAGTGTGTGCACAT

TCCACCCCTGCCAGAGCCACTACAAAGCCAGACCCACAATGTTCTGAGCATG GTCCTGGATCCAGAACTGGAGTTGGCTGACCTTGCCTTCCCACCCCC

TACAACATCTGCTTCCTCCCTGAAAATGCAG GACAAGGAGCTCCGTGCTGTCTTTCTGCGGCTCTTTGCTCAGCTCCTGCAAGGCTACCGCTGGTGCCT

GCACATCGTGCGCATCCACCCAGAGCCCGTCATCCGCTTCCATAAG GCAGCATTCTTAGGCCAGCGTGGACTGGTGGAGGATGATTTCCTGATGAAAGT

ATTGGAGGGCATGGCCTTCGCGGGCTTTGTATCTGAGCGTGGGGTTCCCTACCGTGCCACAGACCTGTTTGATGAG CTGGTGGCTCATGAGGTAGCACG

GATGCGAGCAGATGAGAGCCATCCCCACCGTGTCCTGCGTCATGTCCAGGAACTGGCAGAGCAACTTTATAAGAAT GAAAACCCGTACCCAGCTGTGGC

GATGCACAAAGTGCAGAGGCCAGGAGAGGCCAGTCACCTGCGGCGGACCCACCGGCCATTCCCCCGGCTAGATGAGGGCACAATTCAGTGGATTGTGGAC

CAGGCTGCGGCCAAGATGCAGGGCGCACCTCCAGCTGTCAAGGCTGAGCGGAGGAGCACTGTGCCTTCAGGGCCCCCCATGA CGGCCATACTGGAGCGC

TGTAGTGGGCCTCATATCAACAGTGCACGTCGCTTGGAGGTAGTACGGAATTGCATCTCCTATGTGTTTGAAGGGAAAATGCTTGAGGCAAAGAAG TTG

CTTCCGGCTGTACTCAGGGCCCTGAAGGGGCGAGCTGCCCGTCGCTGCCTTGCCCATGAGCTTCACCTGCACGTACAGCAGAACCGGGCAGTTCTGGATC

ATCAGCAGTTTGACTTTGTCGTCCGCATGATGAATTGCTGCCTGCAG GATTGCACTTCCCTGGATGAGCATGGCATTGCATCTGCACTGCTGCCTTTGG

TCACAGCCTTCTGCAGG AAGCTGAGCCCAGGGGTGACACAGTTTGCATACAGCTGTGTTCAGGAGCACGTAGTGTGGAGCACACCTCAGTTCTGGGAGG

CCATGTTCTATGGGGATGTGCAGACCCATATCCGAGCCCTCTACCTGGAGCCCTCTGATGGCGTGAGCCCCACCCAG GAGACTGGGGAGGCACAGTCTC

AGGATGATGAACGATCTGCCCTGGATGTGGCTTCAGAGCAGAGGCGCCTGTGGCCAACCCTGAGCCGTGAGAAGCAGCAGGAGCTGGTACAGAAGGAGGA

AAGCACTGTGTTCAGCCAGGCCATCCACTATGCCAACCGCATGAGCTACCTTCTGCTGCCTCTGGACAGCAGCAAGAGCCGGCTGCTGCGGGAGCGGGCA

GGGTTGGGAGACCTGGAGAGTGCCAGCAACAGCCTGGTCACCAACAG CATGGCAGGCAGTGTGGCTGAGAGCTATGACACAGAGAGTGGCTTTGAAGAT

GCAGAGACGTGCGATGTGGCTGGGGCTGTAGTCCGCTTCATCAACCGCTTTGTGGACAAAGTCTGCACAGAGAGTGGGGTCACCAGCGACCACCTCAAAG

GACTGCATGTCATGGTGCCAG ACATTGTCCAGATGCACATTGAGACCCTGGAGGCCGTACACCGTGAGAGCAAGAGGCTGCCCCCGATACAGAAG - U

NI2222 - CCCAAGCTGCTGAGGCCACGCCTGTTGCCTGGTGAGGAGTGTGTCCTCGATGGCCTTCGAGTGTATCTGCTGCCAGACGGGCGTGAGGAGG

GTGTAGGAGGCAGTGGAGGGGGCCCTGCTCTACTCCCAGCTGAGGGTGCTGTCTTCCTTACCACATACCGCGTCATCTTCACGGGGATGCCTACTGACCC

CCTGG TGGGGGAGCAGGTGGTAGTCCGCTCCTTCCCCGTGGCTGCCTTGACCAAGGAGAAGCGCATTAGTGTGCAGACCCCTGTGGACCAGCTTCTGCA

GGATGGGCTGCAGCTTCGTTCCTGCACATTCCAG CTGCTGAAAATGGCCTTTGATGAGGAGGTGGGATCTGACAGTGCTGAGCTCTTCCGAAAGCAGCT

ACACAAGCTTCGGTACCCACCAGACATCAGGGCCACCTTTGCATTCACACTTGGCTCAGCTCACACACCTGGCAGGCCGCCACGGGTTACCAAGGACAAG

GGTCCTTCATTCAG AACCCTATCCCGGAACCTGATGAAGAATGCTAAAAAGACCATTGGGCGGCAGTATGTTACTCGTAAGAAGTATAACCCCCCTGGC

TGGGAGCATCGGGGCCAGCCACCCCCTGAGGACCAGGAGGACGAGATCTCAG TGTCAGAGGAGCTGGAGCCTAGCACACTGACCCCGTCCTCAGCCCTG

AAGCCCTCTGACCGCATGACCATGAGCAGCCTGGTGGAACGGGCATGTTGCCGTGACTACCAGCGCCTTGGACTAGGTACCCTGAGCAGCAGCCTGAGCC

GGGCCAAGTCTGAGCCCTTTCGCATCTCTCCTGTTAATCGCATGTATGCCATATGTCGCAG CTATCCAGGATTGCTGATTGTTCCCCAGAGCATCCAGG

ACAACGCCCTGCAGCGTGTATCCCGCTGCTACCGCCAGAACCGCTTCCCTGTGGTCTGCTGGCGCAGTGGGCGCTCCAAGGCTGTCTTGCTACGCTCTGG

GGGCCTGCATGGCAAAGGTGTTGTTGGTCTCTTCAAGGCCCAGAATACACCTTCTCCAG GCCAGGCCCAGGCCGACTCCAGCAGCCTGGAGCAAGAGAA

GTACCTGCAGGCTGTGGTCAGCTCCATGCCACGTTATGCTGACTCATCAGGACGAAACACACTGAGTAGCTTCTCCTCAGCCCACATGGGTGGCCATG G

GAAATGGAGCAGTGTCCGAGCCAGTGGTCGAAGCAGTGGTCTTGGTTCTGATGTGGGCTCTCGGCTAGCTGGCAGAGATCTCCTCAGTACTCCCCACACC

AACGGAGCTCCACCTGATTCTGGTTTTCTACGGCCACAGCGTGCAGCCCTCTACATCATTGGTGACAAAGCTCAGCTCAAG GGTGTGCGCCCAGATCCC

TTGCAACAGTGGGAGCTGGTACCTATTGAAGTATTTGAGGCAAGGCAGGTGAAAGCCAGCTTCAAGAAACTATTGAAAGCCTGTGTGCCTGGTTGCCCTG

CCACTGAGCCCAGCCCAGCCTCTTTTCTGCGCTCACTGGAGGACTCAGAATGGCTGATCCAG ATCCACAAGCTGCTGCAGATATCGGTGCTGGTAGTGG

AGCTGCTCGACTCTGGCTCCTCTGTCCTGGTGAGCCTGGAGGACGGCTGGGACATCACCACTCAG GTGGTATCCTTGGTGCAGCTGCTCTCAGACCCCT

TCTACCGCACTCTGGAAGGCTTCCGACTGCTAGTGGAAAAAGAGTGGCTGTCCTTTGGCCATCGTTTCAGCCACCGCGGGGCCCACACCCTAGCTGGGCA

GAGCAGTGGCTTCACACCCGTCTTCCTGCAGTTCCTGGACTGTGTACACCAG GTCCATTTGCAGTTCCCCATGGAGTTTGAGTTCAGTCAGTTCTACCT

CAAGTTCCTTGGTTACCACCACACATCCCGCCGTTTCCGGACCTTCTTGCTGGACTCTGATTATGAGCGTATTGAGCTGG GGCTGCTGTATGAGGAGAA

GGGTGAACGCAGGGGTCAGCTGGCCTGCAAGTCAGTGTGGGAGTATGTAGACCGGCTAAGCAAGAGGACCCCCATGTTCTACAACTACACATATGCACCC

GAGGACACAGAG GTGCTGCGACCCTACAGCAATGTGTCCAATCTGAAGGTGTGGGATTTCTACACTGAGGAGACGCTGGCTGAGGGGCCCCCTTATGAC

TGGGAGCTGGCCCAGGGACCCCCTGAGCCTCCAGAAGAGGAACGTCCTGATGGAGGTGCTCCCCAGAGCAGGCGCCGTGTGGTATGGCCATGCTATGACA

GCCGTCCTCGAGTCCAGCCTGATGCCATCTCACGTCTGCTGGAG GAGCTGCAGCGCTTGGAGACAGAGTTAGGTCGGCCTTCTGAACGCTGGAAAGACA

CCTGGGACCGGGTGAAGGCTGCTCAGCGCCTTGAAAGCCGGCAAGATGGACGT GGTACCCCCAGCTCACTTCTGGTGTCGGCTGTGCCCCACCACCGCC

GCTCGCTAGGCGTCTATCTACAGGAGGGGCCTGTGGGCTCTACTCTTAGCCTCAGCCTGGACAGTGACCAGAGCAGTGGCTCAACCACATCTAGCTCTCG

GCAGGCCGCCCGGCGGAGCACCAGCACCCTGTACAGCCAGTTCCAGACAGCTGAGAGTGAGAACAG GTCCTATGAGGGCATCCTATACAAGAAGGGGGC

CTTCATGAAGCCCTGGAAAGCCCGTTGGTTTGTCCTAGACAAGACCAAGCACCAG CTGCGATACTATGACCACCGAATGGACACAGAATGCAAGGGTGT

CATTGACCTGGCAGAGGTGGAAGCTGTGGCACCTGGCACACCCACTATAGGTGCCCCTAAGACTGTGGATGAGAAGGCCTTCTTTGAT GTGAAGACAAC

ACGTCGCGTTTACAACTTCTGTGCCCAGGATGTGCCCTCAGCCCAGCAGTGGGTGGACCGGATCCAGAGCTGCCTGTCGGATGCCTGACCCCTCCCGGCC

CTGCCCGGGCTGCTCTGCTTCCAGTCGTTACAGACCACTAGGGGTGGGCAGGGCCGCCCCGGCCATGTTTACAGCCCCGGCCCTCGACAGTATTTGAGGC

CCTGAGCCCCCCCAGCACTTGTGTGTACAGCCCCCGCCCCGCCCCACCTGGCCAGCTCTAACTTATTGTGGTGTCATGGCTGAGCCGTTTAGGGACGCGG

CCATGGTACAGCCCTGCCCTGGGCTTGTAAATAGTCCACCCTACCCGGCCCATCAGTGTGCTGGCCCTGGCCGGCTGGCTGTGCTAAGTTGTTTCTAGAA

CCAGAGTCTATATAAAGAGAGAACTAACGACACAATTGTACGCCTGCATCAGCACTGCATCAGACTGTGGGTCTGCCCA
Translation
MARLADYFVLVAFGPHPRG - UNI36882 - GSGEGQGQILQRFPEKDWEDNPFPQGIEL FCQPSGWQLCPERNPPTFFVAVLTDINSERHYCACLT

FWEPVESTQ EVVCTDNATEKEEEADGGGQARLSSTAPAQPGQLFAPKTLVLVSRLDHAEVFR NSLGLIYAIHVEGLNVSLENVIGNLLTCTVPLAGGS

Q LDSVEEGA RTISLGAGDRQVIQTPLVDSLPVSRCSVALLFRQLG GITNVLSLFCAALTEHKVLFLSRSYQRLADACRGLLALLFPLRYS SFTYVP

ILPAQLLEVLSTPTPFIIGVNAAFQAETQEL LDVIVADLDGGTVTVPECVHIPPLPEPLQSQTHNVLSM VLDPELELADLAFPPPTTSASSLKMQ DK

ELRAVFLRLFAQLLQGYRWCLHIVRIHPEPVIRFHK AAFLGQRGLVEDDFLMKVLEGMAFAGFVSERGVPYRATDLFDE LVAHEVARMRADESHPHRV

LRHVQELAEQLYKN ENPYPAVAMHKVQRPGEASHLRRTHRPFPRLDEGTIQWIVDQAAAKMQGAPPAVKAERRSTVPSGPPMT TAILERCSGPHINSA

RRLEVVRNCISYVFEGKMLEAKK LLPAVLRALKGRAARRCLAHELHLHVQQNRAVLDHQQFDFVVRMMNCCLQ DCTSLDEHGIASALLPLVTAFCR K

LSPGVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPSDGVSPTQ ETGEAQSQDDERSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQ

AIHYANRMSYLLLPLDSSKSRLLRERAGLGDLESASNSLVTNS SMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTESGVTSDHLKGLHVM

VPD DIVQMHIETLEAVHRESKRLPPIQK - UNI2222 - PKLLRPRLLPGEECVLDGLRVYLLPDGREEGVGGSGGGPALLPAEGAVFLTTYRVIFT

GMPTDPLV VGEQVVVRSFPVAALTKEKRISVQTPVDQLLQDGLQLRSCTFQ LLKMAFDEEVGSDSAELFRKQLHKLRYPPDIRATFAFTLGSAHTPGR

PPRVTKDKGPSFR RTLSRNLMKNAKKTIGRQYVTRKKYNPPGWEHRGQPPPEDQEDEISV VSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQR

LGLGTLSSSLSRAKSEPFRISPVNRMYAICRS SYPGLLIVPQSIQDNALQRVSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQNTPSPG

 GQAQADSSSLEQEKYLQAVVSSMPRYADSSGRNTLSSFSSAHMGGHG GKWSSVRASGRSSGLGSDVGSRLAGRDLLSTPHTNGAPPDSGFLRPQRAAL

YIIGDKAQLK GVRPDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPATEPSPASFLRSLEDSEWLIQ IHKLLQISVLVVELLDSGSSVLVSLEDG

WDITTQ VVSLVQLLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGFTPVFLQFLDCVHQ VHLQFPMEFEFSQFYLKFLGYHHTSRRFRT

FLLDSDYERIELG GLLYEEKGERRGQLACKSVWEYVDRLSKRTPMFYNYTYAPEDTE VLRPYSNVSNLKVWDFYTEETLAEGPPYDWELAQGPPEPPE

EERPDGGAPQSRRRVVWPCYDSRPRVQPDAISRLLE ELQRLETELGRPSERWKDTWDRVKAAQRLESRQDGR GTPSSLLVSAVPHHRRSLGVYLQEGP

VGSTLSLSLDSDQSSGSTTSSSRQAARRSTSTLYSQFQTAESENR RSYEGILYKKGAFMKPWKARWFVLDKTKHQ LRYYDHRMDTECKGVIDLAEVEA

VAPGTPTIGAPKTVDEKAFFD VKTTRRVYNFCAQDVPSAQQWVDRIQSCLSDA
Transcript ENSMUST00000081421
Sequence
GGCGGCGGAAGCCCTGGTCAGCGGCGCCGCAGAGGAGCGGGCCCGGGGTGTCCCAAGTGTGCAGCTTAGGGCCAGCGCCGGGCCATGAGCGCGCCGCCAT

CGAACCCTCGAGCCGTGGAGCCCGCCTGCGCCCCTTGCCATGGCGCGGCTCGCGGACTACTTCGTGCTGGTGGCGTTCGGGCCGCACCCGCGCG - UNI

36882 - GGAGTGGGGAAGGCCAGGGCCAGATCCTGCAGCGCTTCCCGGAGAAGGACTGGGAGGACAACCCTTTCCCCCAGGGCATTGAGCTG TTTTG

CCAGCCCAGTGGGTGGCAGCTATGTCCCGAGAGGAATCCACCAACTTTCTTTGTGGCTGTCCTTACTGACATCAACTCTGAGAGGCACTACTGCGCCTGC

TTGACCTTCTGGGAGCCAGTGGAGTCCACACAG GAAGTAGTGTGCACTGACAATGCCACGGAGAAGGAGGAAGAGGCAGATGGAGGAGGCCAAGCGCGG

CTGTCATCCACAGCCCCAGCCCAGCCTGGCCAGCTTTTTGCGCCAAAGACTCTGGTTCTGGTGTCTCGACTGGACCATGCCGAAGTGTTCAGG AATAGC

CTTGGTCTCATCTATGCTATCCACGTGGAAGGCCTGAATGTGAGCCTCGAGAATGTGATCGGGAACCTGCTCACATGTACCGTCCCATTGGCTGGCGGGT

CTCAG AGAACCATCTCTTTGGGGGCTGGTGACCGGCAGGTCATTCAGACTCCACTGGTAGACTCACTGCCTGTCAGCCGCTGTAGTGTAGCCCTGCTCT

TCCGCCAGCTGG GTATCACCAATGTGCTGTCTTTGTTCTGTGCTGCCCTTACTGAGCACAAAGTCCTCTTCTTGTCCAGGAGCTACCAACGTCTAGCAG

ATGCTTGCAGGGGTCTCTTGGCATTGCTGTTCCCTCTCAGATACAG CTTCACTTATGTGCCCATCTTGCCGGCACAGCTGCTGGAAGTCCTTAGCACAC

CTACGCCTTTCATCATTGGGGTCAATGCAGCCTTCCAGGCAGAGACTCAGGAGCTG CTGGATGTGATTGTTGCTGATCTTGACGGAGGGACAGTGACTG

TCCCTGAGTGTGTGCACATTCCACCCCTGCCAGAGCCACTACAAAGCCAGACCCACAATGTTCTGAGCATG GTCCTGGATCCAGAACTGGAGTTGGCTG

ACCTTGCCTTCCCACCCCCTACAACATCTGCTTCCTCCCTGAAAATGCAG GACAAGGAGCTCCGTGCTGTCTTTCTGCGGCTCTTTGCTCAGCTCCTGC

AAGGCTACCGCTGGTGCCTGCACATCGTGCGCATCCACCCAGAGCCCGTCATCCGCTTCCATAAG GCAGCATTCTTAGGCCAGCGTGGACTGGTGGAGG

ATGATTTCCTGATGAAAGTATTGGAGGGCATGGCCTTCGCGGGCTTTGTATCTGAGCGTGGGGTTCCCTACCGTGCCACAGACCTGTTTGATGAG CTGG

TGGCTCATGAGGTAGCACGGATGCGAGCAGATGAGAGCCATCCCCACCGTGTCCTGCGTCATGTCCAGGAACTGGCAGAGCAACTTTATAAGAAT GAAA

ACCCGTACCCAGCTGTGGCGATGCACAAAGTGCAGAGGCCAGGAGAGGCCAGTCACCTGCGGCGGACCCACCGGCCATTCCCCCGGCTAGATGAGGGCAC

AATTCAGTGGATTGTGGACCAGGCTGCGGCCAAGATGCAGGGCGCACCTCCAGCTGTCAAGGCTGAGCGGAGGAGCACTGTGCCTTCAGGGCCCCCCATG

A CGGCCATACTGGAGCGCTGTAGTGGGCCTCATATCAACAGTGCACGTCGCTTGGAGGTAGTACGGAATTGCATCTCCTATGTGTTTGAAGGGAAAATG

CTTGAGGCAAAGAAG TTGCTTCCGGCTGTACTCAGGGCCCTGAAGGGGCGAGCTGCCCGTCGCTGCCTTGCCCATGAGCTTCACCTGCACGTACAGCAG

AACCGGGCAGTTCTGGATCATCAGCAGTTTGACTTTGTCGTCCGCATGATGAATTGCTGCCTGCAG GATTGCACTTCCCTGGATGAGCATGGCATTGCA

TCTGCACTGCTGCCTTTGGTCACAGCCTTCTGCAGG AAGCTGAGCCCAGGGGTGACACAGTTTGCATACAGCTGTGTTCAGGAGCACGTAGTGTGGAGC

ACACCTCAGTTCTGGGAGGCCATGTTCTATGGGGATGTGCAGACCCATATCCGAGCCCTCTACCTGGAGCCCTCTGATGGCGTGAGCCCCACCCAG GAG

ACTGGGGAGGCACAGTCTCAGGATGATGAACGATCTGCCCTGGATGTGGCTTCAGAGCAGAGGCGCCTGTGGCCAACCCTGAGCCGTGAGAAGCAGCAGG

AGCTGGTACAGAAGGAGGAAAGCACTGTGTTCAGCCAGGCCATCCACTATGCCAACCGCATGAGCTACCTTCTGCTGCCTCTGGACAGCAGCAAGAGCCG

GCTGCTGCGGGAGCGGGCAGGGTTGGGAGACCTGGAGAGTGCCAGCAACAGCCTGGTCACCAACAG CATGGCAGGCAGTGTGGCTGAGAGCTATGACAC

AGAGAGTGGCTTTGAAGATGCAGAGACGTGCGATGTGGCTGGGGCTGTAGTCCGCTTCATCAACCGCTTTGTGGACAAAGTCTGCACAGAGAGTGGGGTC

ACCAGCGACCACCTCAAAGGACTGCATGTCATGGTGCCAG ACATTGTCCAGATGCACATTGAGACCCTGGAGGCCGTACACCGTGAGAGCAAGAGGCTG

CCCCCGATACAGAAG - UNI2222 - CCCAAGCTGCTGAGGCCACGCCTGTTGCCTGGTGAGGAGTGTGTCCTCGATGGCCTTCGAGTGTATCTGCTG

CCAGACGGGCGTGAGGAGGGTGTAGGAGGCAGTGGAGGGGGCCCTGCTCTACTCCCAGCTGAGGGTGCTGTCTTCCTTACCACATACCGCGTCATCTTCA

CGGGGATGCCTACTGACCCCCTGG TGGGGGAGCAGGTGGTAGTCCGCTCCTTCCCCGTGGCTGCCTTGACCAAGGAGAAGCGCATTAGTGTGCAGACCC

CTGTGGACCAGCTTCTGCAGGATGGGCTGCAGCTTCGTTCCTGCACATTCCAG CTGCTGAAAATGGCCTTTGATGAGGAGGTGGGATCTGACAGTGCTG

AGCTCTTCCGAAAGCAGCTACACAAGCTTCGGTACCCACCAGACATCAGGGCCACCTTTGCATTCACACTTGGCTCAGCTCACACACCTGGCAGGCCGCC

ACGGGTTACCAAGGACAAGGGTCCTTCATTCAG AACCCTATCCCGGAACCTGATGAAGAATGCTAAAAAGACCATTGGGCGGCAGTATGTTACTCGTAA

GAAGTATAACCCCCCTGGCTGGGAGCATCGGGGCCAGCCACCCCCTGAGGACCAGGAGGACGAGATCTCAG TGTCAGAGGAGCTGGAGCCTAGCACACT

GACCCCGTCCTCAGCCCTGAAGCCCTCTGACCGCATGACCATGAGCAGCCTGGTGGAACGGGCATGTTGCCGTGACTACCAGCGCCTTGGACTAGGTACC

CTGAGCAGCAGCCTGAGCCGGGCCAAGTCTGAGCCCTTTCGCATCTCTCCTGTTAATCGCATGTATGCCATATGTCGCAG CTATCCAGGATTGCTGATT

GTTCCCCAGAGCATCCAGGACAACGCCCTGCAGCGTGTATCCCGCTGCTACCGCCAGAACCGCTTCCCTGTGGTCTGCTGGCGCAGTGGGCGCTCCAAGG

CTGTCTTGCTACGCTCTGGGGGCCTGCATGGCAAAGGTGTTGTTGGTCTCTTCAAGGCCCAGAATACACCTTCTCCAG GCCAGGCCCAGGCCGACTCCA

GCAGCCTGGAGCAAGAGAAGTACCTGCAGGCTGTGGTCAGCTCCATGCCACGTTATGCTGACTCATCAGGACGAAACACACTGAGTAGCTTCTCCTCAGC

CCACATGGGTGGCCATG GGAAATGGAGCAGTGTCCGAGCCAGTGGTCGAAGCAGTGGTCTTGGTTCTGATGTGGGCTCTCGGCTAGCTGGCAGAGATCT

CCTCAGTACTCCCCACACCAACGGAGCTCCACCTGATTCTGGTTTTCTACGGCCACAGCGTGCAGCCCTCTACATCATTGGTGACAAAGCTCAGCTCAAG

 GGTGTGCGCCCAGATCCCTTGCAACAGTGGGAGCTGGTACCTATTGAAGTATTTGAGGCAAGGCAGGTGAAAGCCAGCTTCAAGAAACTATTGAAAGCC

TGTGTGCCTGGTTGCCCTGCCACTGAGCCCAGCCCAGCCTCTTTTCTGCGCTCACTGGAGGACTCAGAATGGCTGATCCAG ATCCACAAGCTGCTGCAG

ATATCGGTGCTGGTAGTGGAGCTGCTCGACTCTGGCTCCTCTGTCCTGGTGAGCCTGGAGGACGGCTGGGACATCACCACTCAG GTGGTATCCTTGGTG

CAGCTGCTCTCAGACCCCTTCTACCGCACTCTGGAAGGCTTCCGACTGCTAGTGGAAAAAGAGTGGCTGTCCTTTGGCCATCGTTTCAGCCACCGCGGGG

CCCACACCCTAGCTGGGCAGAGCAGTGGCTTCACACCCGTCTTCCTGCAGTTCCTGGACTGTGTACACCAG GTCCATTTGCAGTTCCCCATGGAGTTTG

AGTTCAGTCAGTTCTACCTCAAGTTCCTTGGTTACCACCACACATCCCGCCGTTTCCGGACCTTCTTGCTGGACTCTGATTATGAGCGTATTGAGCTGG 

GGCTGCTGTATGAGGAGAAGGGTGAACGCAGGGGTCAGCTGGCCTGCAAGTCAGTGTGGGAGTATGTAGACCGGCTAAGCAAGAGGACCCCCATGTTCTA

CAACTACACATATGCACCCGAGGACACAGAG GTGCTGCGACCCTACAGCAATGTGTCCAATCTGAAGGTGTGGGATTTCTACACTGAGGAGACGCTGGC

TGAGGGGCCCCCTTATGACTGGGAGCTGGCCCAGGGACCCCCTGAGCCTCCAGAAGAGGAACGTCCTGATGGAGGTGCTCCCCAGAGCAGGCGCCGTGTG

GTATGGCCATGCTATGACAGCCGTCCTCGAGTCCAGCCTGATGCCATCTCACGTCTGCTGGAG GAGCTGCAGCGCTTGGAGACAGAGTTAGGTCGGCCT

TCTGAACGCTGGAAAGACACCTGGGACCGGGTGAAGGCTGCTCAGCGCCTTGAAAGCCGGCAAGATGGACGT GGTACCCCCAGCTCACTTCTGGTGTCG

GCTGTGCCCCACCACCGCCGCTCGCTAGGCGTCTATCTACAGGAGGGGCCTGTGGGCTCTACTCTTAGCCTCAGCCTGGACAGTGACCAGAGCAGTGGCT

CAACCACATCTAGCTCTCGGCAGGCCGCCCGGCGGAGCACCAGCACCCTGTACAGCCAGTTCCAGACAGCTGAGAGTGAGAACAG GTCCTATGAGGGCA

TCCTATACAAGAAGGGGGCCTTCATGAAGCCCTGGAAAGCCCGTTGGTTTGTCCTAGACAAGACCAAGCACCAG CTGCGATACTATGACCACCGAATGG

ACACAGAATGCAAGGGTGTCATTGACCTGGCAGAGGTGGAAGCTGTGGCACCTGGCACACCCACTATAGGTGCCCCTAAGACTGTGGATGAGAAGGCCTT

CTTTGAT GTGAAGACAACACGTCGCGTTTACAACTTCTGTGCCCAGGATGTGCCCTCAGCCCAGCAGTGGGTGGACCGGATCCAGAGCTGCCTGTCGGA

TGCCTGACCCCTCCCGGCCCTGCCCGGGCTGCTCTGCTTCCAGTCGTTACAGACCACTAGGGGTGGGCAGGGCCGCCCCGGCCATGTTTACAGCCCCGGC

CCTCGACAGTATTTGAGGCCCTGAGCCCCCCCAGCACTTGTGTGTACAGCCCCCGCCCCGCCCCACCTGGCCAGCTCTAACTTATTGTGGTGTCATGGCT

GAGCCGTTTAGGGACGCGGCCATGGTACAGCCCTGCCCTGGGCTTGTAAATAGTCCACCCTACCCGGCCCATCAGTGTGCTGGCCCTGGCCGGCTGGCTG

TGCTAAGTTGTTTCTAGAACCAGAGTCTATATAAAGAGAGAACTAACG
Translation
ARRHRTLEPWSPPAPLAMARLADYFVLVAFGPHPRG - UNI36882 - GSGEGQGQILQRFPEKDWEDNPFPQGIEL FCQPSGWQLCPERNPPTFFV

AVLTDINSERHYCACLTFWEPVESTQ EVVCTDNATEKEEEADGGGQARLSSTAPAQPGQLFAPKTLVLVSRLDHAEVFR NSLGLIYAIHVEGLNVSLE

NVIGNLLTCTVPLAGGSQ RTISLGAGDRQVIQTPLVDSLPVSRCSVALLFRQLG GITNVLSLFCAALTEHKVLFLSRSYQRLADACRGLLALLFPLRY

S SFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQEL LDVIVADLDGGTVTVPECVHIPPLPEPLQSQTHNVLSM VLDPELELADLAFPPPTTSAS

SLKMQ DKELRAVFLRLFAQLLQGYRWCLHIVRIHPEPVIRFHK AAFLGQRGLVEDDFLMKVLEGMAFAGFVSERGVPYRATDLFDE LVAHEVARMRA

DESHPHRVLRHVQELAEQLYKN ENPYPAVAMHKVQRPGEASHLRRTHRPFPRLDEGTIQWIVDQAAAKMQGAPPAVKAERRSTVPSGPPMT TAILERC

SGPHINSARRLEVVRNCISYVFEGKMLEAKK LLPAVLRALKGRAARRCLAHELHLHVQQNRAVLDHQQFDFVVRMMNCCLQ DCTSLDEHGIASALLPL

VTAFCR KLSPGVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPSDGVSPTQ ETGEAQSQDDERSALDVASEQRRLWPTLSREKQQELVQK

EESTVFSQAIHYANRMSYLLLPLDSSKSRLLRERAGLGDLESASNSLVTNS SMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTESGVTSD

HLKGLHVMVPD DIVQMHIETLEAVHRESKRLPPIQK - UNI2222 - PKLLRPRLLPGEECVLDGLRVYLLPDGREEGVGGSGGGPALLPAEGAVFL

TTYRVIFTGMPTDPLV VGEQVVVRSFPVAALTKEKRISVQTPVDQLLQDGLQLRSCTFQ LLKMAFDEEVGSDSAELFRKQLHKLRYPPDIRATFAFTL

GSAHTPGRPPRVTKDKGPSFR RTLSRNLMKNAKKTIGRQYVTRKKYNPPGWEHRGQPPPEDQEDEISV VSEELEPSTLTPSSALKPSDRMTMSSLVER

ACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRS SYPGLLIVPQSIQDNALQRVSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFK

AQNTPSPG GQAQADSSSLEQEKYLQAVVSSMPRYADSSGRNTLSSFSSAHMGGHG GKWSSVRASGRSSGLGSDVGSRLAGRDLLSTPHTNGAPPDSGF

LRPQRAALYIIGDKAQLK GVRPDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPATEPSPASFLRSLEDSEWLIQ IHKLLQISVLVVELLDSGSS

VLVSLEDGWDITTQ VVSLVQLLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGFTPVFLQFLDCVHQ VHLQFPMEFEFSQFYLKFLGYH

HTSRRFRTFLLDSDYERIELG GLLYEEKGERRGQLACKSVWEYVDRLSKRTPMFYNYTYAPEDTE VLRPYSNVSNLKVWDFYTEETLAEGPPYDWELA

QGPPEPPEEERPDGGAPQSRRRVVWPCYDSRPRVQPDAISRLLE ELQRLETELGRPSERWKDTWDRVKAAQRLESRQDGR GTPSSLLVSAVPHHRRSL

GVYLQEGPVGSTLSLSLDSDQSSGSTTSSSRQAARRSTSTLYSQFQTAESENR RSYEGILYKKGAFMKPWKARWFVLDKTKHQ LRYYDHRMDTECKGV

IDLAEVEAVAPGTPTIGAPKTVDEKAFFD VKTTRRVYNFCAQDVPSAQQWVDRIQSCLSDA

For any suggestions or comments, please send an email to unitrap@crg.es