Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036545 (Adamts2)
Chromosomal location
Chr 11: 50415587 - 50617551 (+)
Description
a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 2 Gene [Source:MGI (curated);Acc:Adamts2-001]
RefSeq_dna
NM_175643 
RefSeq_peptide
NP_783574.1 
MGI
MGI:1347356 
Uniprot/SWISSPROT
Q8C9W3 
Uniprot/SPTREMBL
Q1LZL1 Q5DTQ6 Q5NCH8 
Human Ortholog
ENSG00000087116 (ADAMTS2)
Omim 225410 - EHLERS-DANLOS SYNDROME, TYPE VII, AUTOSOMAL RECESSIVE  
UniTrap UNI31726
Vector Insertion
Chr 11: 50415802 - 50416738
Public Clones IST10672B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37935
Vector Insertion
Chr 11: 50417134 - 50481492
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28572
Vector Insertion
Chr 11: 50610031 - 50617070
Public Clones not available
Private Clones OST27658 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040523
Sequence
CCCAGATGTGGGCTGGGCAGCGCGCGGGGAACTTTCGCGCCGGCTGCGAGTGCGGGGCCCCGGCTGCGGTCGGGCTGCCATGGATCCGCCGGCGGGAGCC

GCTCGCCGCCTGCTCTGCCCCGCTCTACTGCTGCTGCTGCTGCCGCCGCCGCCTCTCCTGCTGCTGCCGCCGCCGCCCGCGAGCGTCCGGCTCGTCGCCG

CCACCGAGCCCCCAG - UNI31726 - GCGGGCCCCCGGGGCAAGGAGCCGAGCGCATCCTGGCGGTGCCGGTGCGCACTGACGCCCAGGGCCGCTTG

GTGTCCCACGTGGTGTCTTTGGAGACGGCCGGGGCGGGGGTACGAGCCCGCAGAGCTGCCCTGGACCAGACCTCGGGCTTGCCCGGAGGCGCTGCTCAGG

ACCCTGGAGGACGCCTTTTCTACAACCTCACAGTATTCGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCCCGGCTCGTGGCTCCGGGGGCCACCGT

GGAGTGGCAGGGTGAGACGGGTGACACCCGAGTGGAGCCCCTGCTTGGGAGCTGTCTCTACGTTGGAGACGTGGCAGACTTACCTAAAGCCTCCTCGGTG

GCGCTCAGTAACTGTGATGGGCTG GCTGGTCTGATCCGGATGGAGGAGGAGGAGTTCTTTATCGAACCTCTGGAGAAGGGGCAGACGGATCAGGAGGCT

GAACAAGGCCGAGTGCATGTGGTATATCGCCGACCGCCCACTCCCAAGCCCCCTCCTGTGAGCGAACCACAGGCTCTGGACACAG GAGTCTCCCAGGGC

AACCTGGACAGCCTCAGCAGAGCCCTAGGCGTCCTGGAGGAGCGCATCAACAGCTCACGGCGGAGGGTGCGCAGGCATGCCACGGACGATGACTACAACA

TTGAGGTCCTGCTGGGTGTGGATGACTCGGTGGTCCAGTTCCATGGGAAGGAGCACGTGCAGAAGTACCTGCTGACACTCATGAACATT GTCAACGAAA

TCTACCATGATGAGTCGTTGGGGGCCCACATCAATGTGGTGCTGGTGAGGATTATCCTGCTGAGCCACGCAAAG TCCATGAGCCTCATTGAGATTGGAA

ACCCCTCTCAGAGTCTGGAGAATGTCTGCCGATGGGCCTACCTCCAGCAGAAGCCGGACACAGACCACGATGAGTACCACGACCATGCCATCTTTCTCAC

ACGGCAGGATTTTGGGCCCTCGGGCATGCAAG GCTATGCTCCCGTCACCGGGATGTGCCACCCTGTCCGCAGCTGTACTCTGAACCATGAAGATGGCTT

CTCCTCGGCATTTGTGGTGGCTCACGAGACGGGCCATGT GCTGGGCATGGAGCATGACGGGCAAGGCAACCGCTGCGGTGACGAGGTGCGGCTGGGCAG

CATCATGGCCCCCCTGGTACAGGCTGCCTTCCATCGCTTCCACTGGTCCCGCTGCAGCCAGCAGGAGCTCAGCCGCTACCTGCA TTCCTATGACTGCCT

GCGGGATGATCCCTTCGCCCACGACTGGCCAGCATTGCCTCAACTCCCAGGGCTTCACTATTCCATGAACGAGCAGTGTCGCTTTGACTTTGGCCTGGGT

TACATGATGTGCACTGCG TTCCGGACCTTCGACCCCTGCAAACAGCTCTGGTGCAGCCACCCAGACAACCCCTACTTTTGCAAGACAAAGAAGGGTCCT

CCACTGGATGGTACTATGTGTGCGCCTGGCAAG CACTGCTTCAAAGGCCACTGCATCTGGCTGACACCCGATATCCTCAAACGAGACGGCAACTGGGGT

GCCTGGACTCCGTTTGGCTCCTGCTCACGCACCTGTGGCACAGGCGTGAAGTTCAGGACCCGCCAGTGTGACAACCCACA TCCAGCCAATGGGGGCCGC

ACCTGCTCGGGCCTGGCCTATGACTTCCAGCTCTGCAACCCCCAGGACTGTCCCAATTCCCTGGCTGACTTCCGGGAGGAGCAGTGTCAGCAGTGGGACC

TGTACTTTGAGCACGGTGATGTCCAGCACCACTGGCTGCCTCATGAGCACCGGGATG CCAAGGAGAGATGCCACCTCTACTGTGAGTCCAAGGAGACAG

GGGAGGTGGTGTCTATGAAGCGCATGGTGCACGATGGAACACGCTGCTCCTACAAGGACGCCTTCAGCCTGTGTGTGCGTGGGGACTGCAGG AAAGTGG

GATGTGATGGGGTGATCGGGTCCCGTAAGCAGGAAGACAAGTGTGGCGTGTGTGGAGGCGACAACACCCACTGTAAAGTGGTGAAGGGCACATTCACGAG

GTCACCGAGGAAACAAG ATTACATCAAGATGTTTGAGATCCCCGCAGGAGCCAGACACCTGCTCATCCAGGAGGCCGACACCACCAGCCACCATCTGT 

CTGTCAAGAACCTGGAGACAGGCAAGTTCATCTTAAATGAAGAGAACCACTTGGACCCCAATTCTAGATCCTTCATTGCCATGGGTGTGGAGTGGGAATA

CAGGAACGAGGACGAGAGGGAGACGCTGCAGACCATAGGCCCACTCCACGGAACCATCACCGTGCTG GTTATTCCTGAAGGAGACACCAGGATCTCACT

GACATACAAATACATGATTCACGAGGACTCCCTCAATGTTGACGACAACAATGTCCTGGAAGATGATGCTGTGCGCCACGAGTGGGCCCTGAAGAAGTGG

TCTCCCTGCTCCAAGCCCTGCGGTGGAG GGTCCCAGTTCACTAAGTATGGCTGCCGCCGGAGGTTGGACAGCAAGATGGTACACCGAGCCTTCTGCAGT

GCCCTCGCCAAGCCCAAGGCCATCCGACGAGCCTGCAACCCTCAGGAGTGCTCCCAGCCTGT GTGGGTCACCGGTGAATGGGAGCCTTGTACTCAAAGC

TGTGGGCGAACTGGCATGCAGGTGCGCTCCGTCCGCTGTATACAACCTCTGCACAACAACACCACCCGCTCCGTGCACACCAAACACTGCAACGATCACC

GTCCCGAGAGCCGCCGGGCCTGCAACCGTGAGCTCTGCCCTGGGCGGTGGCGGGCTGGGTCCTGGTCCCAG TGTTCGGTAACCTGTGGCAACGGCACCC

AGGAACGGCCAGTGCTCTGTCGCACTGCAGATGATAATTTTGGTGTCTGCCGGGAGGAGCGACCGGAGACGGCAAGGATCTGCAGGCTTGCACCCTGTCC

CC GAAACGGCTCAGATCCCTCCAAGAAGAGCTACGTGGTTCAGTGGCTGTCCCGGCCTGATCCTGACTCACCTATCCAGAAGATCTCGTCAA - UNI2

8572 - AGGACCAGTGCCAAGGCGACAAGTCAATGTTCTGTAGGATGGAAGTCTTGTCTCGCTACTGCTCCATCCCCAGCTACAACAAGCTTTGCTGCA

AGTCCTGCAACCCGCCCCGAAACCTCAGCAACACAGAGGACGGAGGTGTGGAGCCTCCTCCCGGGAAGCACAATGACATCGATGTGTTCATGCCCACACT

CCCGGGGCCCACTGTAGCTACACAGGTGCAGCCTTCTCCGGGGCCTCCTTTGGAGGCTCCCCTCAATGTCTCTAGCACCAATGCCACTGAAGATCACCCA

GAAACCAATGCTGTGGATGTCCCCTACAAAATCCATGGTGTGGATGAAGAGGTCCCGTCTCCTAACCTGATCCCTCGACGGCCAAGCCTGTATGTAAAGA

CAAGGAACCAAAGAATCCAGGAGCTCATTAATGCAGTGCAGAGGAAAGAGAAGCCGGGAAAGTTCTAATAAAAATAGAAAGATTCGCA
Translation
MDPPAGAARRLLCPALLLLLLPPPPLLLLPPPPASVRLVAATEPPG - UNI31726 - GGPPGQGAERILAVPVRTDAQGRLVSHVVSLETAGAGVRA

RRAALDQTSGLPGGAAQDPGGRLFYNLTVFGRDLHLRLRPNARLVAPGATVEWQGETGDTRVEPLLGSCLYVGDVADLPKASSVALSNCDGL AGLIRME

EEEFFIEPLEKGQTDQEAEQGRVHVVYRRPPTPKPPPVSEPQALDTG GVSQGNLDSLSRALGVLEERINSSRRRVRRHATDDDYNIEVLLGVDDSVVQF

HGKEHVQKYLLTLMNI VNEIYHDESLGAHINVVLVRIILLSHAK SMSLIEIGNPSQSLENVCRWAYLQQKPDTDHDEYHDHAIFLTRQDFGPSGMQG 

GYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHV VLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLH HSYDCLRDDPFAH

DWPALPQLPGLHYSMNEQCRFDFGLGYMMCTA FRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGK HCFKGHCIWLTPDILKRDGNWGAWTPFG

SCSRTCGTGVKFRTRQCDNPH HPANGGRTCSGLAYDFQLCNPQDCPNSLADFREEQCQQWDLYFEHGDVQHHWLPHEHRDA AKERCHLYCESKETGEV

VSMKRMVHDGTRCSYKDAFSLCVRGDCR KVGCDGVIGSRKQEDKCGVCGGDNTHCKVVKGTFTRSPRKQD DYIKMFEIPAGARHLLIQEADTTSHHLS

 SVKNLETGKFILNEENHLDPNSRSFIAMGVEWEYRNEDERETLQTIGPLHGTITVL VIPEGDTRISLTYKYMIHEDSLNVDDNNVLEDDAVRHEWALK

KWSPCSKPCGGG GSQFTKYGCRRRLDSKMVHRAFCSALAKPKAIRRACNPQECSQPV VWVTGEWEPCTQSCGRTGMQVRSVRCIQPLHNNTTRSVHTK

HCNDHRPESRRACNRELCPGRWRAGSWSQ CSVTCGNGTQERPVLCRTADDNFGVCREERPETARICRLAPCPR RNGSDPSKKSYVVQWLSRPDPDSPI

QKISSK - UNI28572 - KDQCQGDKSMFCRMEVLSRYCSIPSYNKLCCKSCNPPRNLSNTEDGGVEPPPGKHNDIDVFMPTLPGPTVATQVQPSPGP

PLEAPLNVSSTNATEDHPETNAVDVPYKIHGVDEEVPSPNLIPRRPSLYVKTRNQRIQELINAVQRKEKPGKF

For any suggestions or comments, please send an email to unitrap@crg.es