Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036572 (Upf3b)
Chromosomal location
Chr X: 34631829 - 34650317 (-)
Description
UPF3 regulator of nonsense transcripts homolog B (yeast) Gene [Source:MGI (curated);Acc:Upf3b-001]
RefSeq_dna
NM_026573 
RefSeq_peptide
NP_080849.1 
UniGene
Mm.421926 
MGI
MGI:3770264 MGI:1915384 
Uniprot/SPTREMBL
B1APM6 Q149I6 Q3ULL6 Q80UI8 Q9CS15 
Human Ortholog
ENSG00000125351 (UPF3B)
Omim 300676 - MENTAL RETARDATION, X-LINKED, SYNDROMIC 14  
UniTrap UNI17576
Vector Insertion
Chr X: 34649142 - 34649250
Public Clones not available
Private Clones OST440452 (lexicon) OST132975 (lexicon) OST29256 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23953
Vector Insertion
Chr X: 34649017 - 34649142
Public Clones not available
Private Clones OST239478 (lexicon) OST20998 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14812
Vector Insertion
Chr X: 34640087 - 34642133
Public Clones PST12136-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19758
Vector Insertion
Chr X: 34639685 - 34640087
Public Clones not available
Private Clones OST381656 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34278
Vector Insertion
Chr X: 34631828 - 34635782
Public Clones IST11273F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115219
Sequence
GGAGCTCCTGAGGTCTCTCCCGGAGAGTCGTAGGTGCCCGGCGTAACGGCTTAGCAGCTGTGCCACCGCTCTAAAGAGCGTAACCGTGGCCATGAAGGAA

GAAAAAGATCATAGGCCTAAGGAGAAACGAGTGACCCTGTTTACGCCGCAGGGCGCCACAGGCGGCTGTATTGGCGCTACTGCCGAAGGCGCCAAAGGGG

ACGATAGGCAGGATCGCAACAGGGACAAGAAAGAAGCTTTGAGCAAG - UNI17576 - GTGGTAATTCGAAGATTACCTCCCACTTTGACCAAGGAA

CAGCTTCAGGAACATCTTCAACCTATGCCTGAGCACGATTATTTTGAGTTTTTTTCTAATGATACTAG - UNI17576 - - UNI23953 - CCTTT

ATCCTCATATGTATGCCAGAGCATATATCAACTTTAAAAACCAAGAAGACATTCTTTTATTCAGGGACCGATTTGATGGCTATGTATTCCTTGACAATAA

GG GTCAAGAATATCATGCTATAGTAGAATTTGCACCATTTCAAAAAGCTGCAAAAAAGAAGATTAAGAAAAGAGATACAAAAGTTGGGACTATCGAGGA

TG - UNI14812 - ATCCAGAATACAGAAAATTTTTGGAGAGTTATGCCACAGACAATGAGAAAATGACATCTACTCCAGAGACATTGCTGGAGGAAA

TTGAAGCCAAAAATCGAGAATTAATAG - UNI14812 - CTAAAAGGACAACGCCCCTTTTGAGCTTCCTGAAGAACAAGCAA - UNI14812 - -

 UNI19758 - AGAATGAGAGAAGAAAAGAGAGAAGAAAGGAGGAGACGGGAAATAGAGAGGAAAAGGCAAAGAGAAGAAGAGAGAAGAAAATGGAAAG

AAGAGGAGAAACGAAAAAGAAAAGATATAGAAAAACTAAAGAAGATAGAAAGAATTCCAGAAAGGGAGAAAATAAGGGATGAACCAAAGATTAAG GTAC

ACAGGTTTCTGTTACAAGCTGTGAATCAGAAAAAT TTGCTCAGGAAACCGGAAAAAGGAGATGAAAAAGAACTTGATAAAAGAGACAAAACCAAGAGAC

TGGACAAAGAAAATCTGAATGAAGAAAGAGCCAGTGGGCACAGTTATACTCTGCCCAGGCGTTCTGATGTCGAACTGAAGGATGAAAAGCCAAAGAG GC

TCGATGACGAGGGTGTCAGAGATTACAGAGACAGGGACCGGGACTATGAGAGAGATCAGGAGCGCATGATCCGAGAAAGAGAGAGGCTGAAGCGGCAAGA

AGAAGAGCGCCGGCGGCAGCAGCAGAAAGAACGCTATGAGAAAGAGAAGGCTTTTAAGCGAAAGGAAGAAGAAATGAAGAGAGAGAAAGAGGCACTTCGA

GATAAAGGAAAGAAGAGTGAGAATACAGAATCAATATGCTCATTAGAAAAAATTGAAAAAAAAGAGGAAGTGGTTAAGAGAGACCGCATAAGGAACAAG 

- UNI34278 - GATCGTCCAGCCATGCAGCTTTACCAACCAGGAGCTCGAAGCCGAAGCCGACTCTGTCCCGCCGATGACAGCATCAAGCCTGGAGAT

TCCCCAGTGGACAAAAAGCAGGAAAGTGGTATTAGCCATAGAAAAGAAGGAGGAGAGGAGTGAGAAGTCCAAATGGTCATAGGTGTCCTGACTGTCCAGG

CAGCCAAAGAGCACGTATTATGCTATCCAGAAGTGCCTTCAGGGCAAAGGAACAGAGAACAAGAAAAGGGGTCGCTGTGCTGGTGGGATGTACTACAGAG

GAGTGTGTCTAAGCAGAATAAGATTGCAGGCTCAGAACCGAAGGACAATTTCATTGTTTTCTGCAGTTTCCACAAGTTAATTTTAATGTCTCAGAAAAAG

ATGGTAGCAAGAACATTGCAAGTGAAAAATGTCAAATAAGGGCTTAACTTTGTATGACAGCTAAAAAGAGCAGGTTCGAAAATCAATGGGTGCTCTTAAT

CCTGGCTTGGAGCATCTTCGTTTGAGTGGAGCAGAAACACACTAAGTTTCGTTGGGATCTAACTATTTTGCATTGTTGGTGTTGACTGTTGACTCTGTAG

TGTAGGAGCAATGAGCATGTAATTGTAGCACAAGTAGAGCGGAGGATAGAGCAAATTATGGCTGATGGAAAAGATTTAAATAGTCACGTTACATCTATAT

CCTGTGTCTGAAGTTTTCATAATTACAGCTTGTTTTAATTCTGTAAATGTAGCATCAAAAATTCCTTGTAAACATCTCGTTTTTGCCTTTAGCGTTTTTT

CCTATTACTAGGTAAAATGTAGCCCTTGGCTAGTTACTGAC
Translation
 - UNI17576 -  - UNI17576 - - UNI23953 - MYARAYINFKNQEDILLFRDRFDGYVFLDNKG GQEYHAIVEFAPFQKAAKKKIKKRDT

KVGTIEDD - UNI14812 - DPEYRKFLESYATDNEKMTSTPETLLEEIEAKNRELIA - UNI14812 - AKRTTPLLSFLKNKQ - UNI14812

 - - UNI19758 - RMREEKREERRRREIERKRQREEERRKWKEEEKRKRKDIEKLKKIERIPEREKIRDEPKIK VHRFLLQAVNQKN LLRKPEKG

DEKELDKRDKTKRLDKENLNEERASGHSYTLPRRSDVELKDEKPKR RLDDEGVRDYRDRDRDYERDQERMIRERERLKRQEEERRRQQQKERYEK - U

NI34278 - 
Transcript ENSMUST00000115221
Sequence
GGAGCTCCTGAGGTCTCTCCCGGAGAGTCGTAGGTGCCCGGCGTAACGGCTTAGCAGCTGTGCCACCGCTCTAAAGAGCGTAACCGTGGCCATGAAGGAA

GAAAAAGATCATAGGCCTAAGGAGAAACGAGTGACCCTGTTTACGCCGCAGGGCGCCACAGGCGGCTGTATTGGCGCTACTGCCGAAGGCGCCAAAGGGG

ACGATAGGCAGGATCGCAACAGGGACAAGAAAGAAGCTTTGAGCAAG - UNI17576 - GTGGTAATTCGAAGATTACCTCCCACTTTGACCAAGGAA

CAGCTTCAGGAACATCTTCAACCTATGCCTGAGCACGATTATTTTGAGTTTTTTTCTAATGATACTAG - UNI17576 - - UNI23953 - CCTTT

ATCCTCATATGTATGCCAGAGCATATATCAACTTTAAAAACCAAGAAGACATTCTTTTATTCAG - UNI14812 - - UNI19758 - - UNI3427

8 - GGACCGGGACTATGAGAGAGATCAGGAGCGCATGATCCGAGAAAGAGAGAGGCTGAAGCGGCAAGAAGAAGAGCGCCGGCGGCAGCAGCAGAAAGA

ACGCTATGAGAAAGAGAAGGCTTTTAAGCGAAAGGAAGAAGAAATGAAGAGAGAGAAAGAGGCACTTCGAGATAAAGGAAAGAAGAGTGAGAATACAGAA

TCAATATGCTCATTAGAAAAAATTGAAAAAAAAGAGGAAGTGGTTAAGAGAGACCGCATAAGGAACAAG - UNI34278 - GATCGTCCAGCCATGCA

GCTTTACCAACCAGGAGCTCGAAGCCGAAGCCGACTCTGTCCCGCCGATGACAGCATCAAGCCTGGAGATTCCCCAGTGGACAAAAAGCAGGAAAGTGGT

ATTAGCCATAGAAAAGAAGGAGGAGAGGAGTGAGAAGTCCAAATGGTCATAGGTGTCCTGACTGTCCAGGCAGCCAAAGAGCACGTATTATGCTATCCAG

AAGTGCCTTCAGGGCAAAGGAACAGAGAACAAGAAAAGGGGTCGCTGTGCTGGTGGGATGTACTACAGAGGAGTGTGTCTAAGCAGAATAAGATTGCAGG

CTCAGAACCGAAGGACAATTTCATTGTTTTCTGCAGTTTCCACAAGTTAATTTTAATGTCTCAGAAAAAGATGGTAGCAAGAACATTGCAAGTGAAAAAT

GTCAAATAAGGGCTTAACTTTGTATGACAGCTAAAAAGAGCAGGTTCGAAAATCAATGGGTGCTCTTAATCCTGGCTTGGAGCATCTTCGTTTGAGTGGA

GCAGAAACACACTAAGTTTCGTTGGGATCTAACTATTTTGCATTGTTGGTGTTGACTGTTGACTCTGTAGTGTAGGAGCAATGAGCATGTAATTGTAGCA

CAAGTAGAGCGGAGGATAGAGCAAATTATGGCTGATGGAAAAGATTTAAATAGTCACGTTACATCTATATCCTGTGTCTGAAGTTTTCATAATTACAGCT

TGTTTTAATTCTGTAAATGTAGCATCAAAAATTCCTTGTAAACATCTCGTTTTTGCCTTTAGCGTTTTTTCCTATTACTAGGTAAAATGTAGCCCTTGGC

TAGTTACTGAC
Translation
MKEEKDHRPKEKRVTLFTPQGATGGCIGATAEGAKGDDRQDRNRDKKEALSK - UNI17576 - VVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSND

TS - UNI17576 - - UNI23953 - SLYPHMYARAYINFKNQEDILLFR - UNI14812 - - UNI19758 - - UNI34278 - RDRDYER

DQERMIRERERLKRQEEERRRQQQKERYEKEKAFKRKEEEMKREKEALRDKGKKSENTESICSLEKIEKKEEVVKRDRIRNK - UNI34278 - DRPA

MQLYQPGARSRSRLCPADDSIKPGDSPVDKKQESGISHRKEGGEE
Transcript ENSMUST00000076265
Sequence
GGAGCTCCTGAGGTCTCTCCCGGAGAGTCGTAGGTGCCCGGCGTAACGGCTTAGCAGCTGTGCCACCGCTCTAAAGAGCGTAACCGTGGCCATGAAGGAA

GAAAAAGATCATAGGCCTAAGGAGAAACGAGTGACCCTGTTTACGCCGCAGGGCGCCACAGGCGGCTGTATTGGCGCTACTGCCGAAGGCGCCAAAGGGG

ACGATAGGCAGGATCGCAACAGGGACAAGAAAGAAGCTTTGAGCAAG - UNI17576 - GTGGTAATTCGAAGATTACCTCCCACTTTGACCAAGGAA

CAGCTTCAGGAACATCTTCAACCTATGCCTGAGCACGATTATTTTGAGTTTTTTTCTAATGATACTAG - UNI17576 - - UNI23953 - CCTTT

ATCCTCATATGTATGCCAGAGCATATATCAACTTTAAAAACCAAGAAGACATTCTTTTATTCAGGGACCGATTTGATGGCTATGTATTCCTTGACAATAA

GG GTCAAGAATATCATGCTATAGTAGAATTTGCACCATTTCAAAAAGCTGCAAAAAAGAAGATTAAGAAAAGAGATACAAAAGTTGGGACTATCGAGGA

TG - UNI14812 - ATCCAGAATACAGAAAATTTTTGGAGAGTTATGCCACAGACAATGAGAAAATGACATCTACTCCAGAGACATTGCTGGAGGAAA

TTGAAGCCAAAAATCGAGAATTAATAG - UNI14812 - CTAAAAGGACAACGCCCCTTTTGAGCTTCCTGAAGAACAAGCAA - UNI14812 - -

 UNI19758 - AGAATGAGAGAAGAAAAGAGAGAAGAAAGGAGGAGACGGGAAATAGAGAGGAAAAGGCAAAGAGAAGAAGAGAGAAGAAAATGGAAAG

AAGAGGAGAAACGAAAAAGAAAAGATATAGAAAAACTAAAGAAGATAGAAAGAATTCCAGAAAGGGAGAAAATAAGGGATGAACCAAAGATTAAG TTGC

TCAGGAAACCGGAAAAAGGAGATGAAAAAGAACTTGATAAAAGAGACAAAACCAAGAGACTGGACAAAGAAAATCTGAATGAAGAAAGAGCCAGTGGGCA

CAGTTATACTCTGCCCAGGCGTTCTGATGTCGAACTGAAGGATGAAAAGCCAAAGAG GCTCGATGACGAGGGTGTCAGAGATTACAGAGACAGGGACCG

GGACTATGAGAGAGATCAGGAGCGCATGATCCGAGAAAGAGAGAGGCTGAAGCGGCAAGAAGAAGAGCGCCGGCGGCAGCAGCAGAAAGAACGCTATGAG

AAAGAGAAGGCTTTTAAGCGAAAGGAAGAAGAAATGAAGAGAGAGAAAGAGGCACTTCGAGATAAAGGAAAGAAGAGTGAGAATACAGAATCAATATGCT

CATTAGAAAAAATTGAAAAAAAAGAGGAAGTGGTTAAGAGAGACCGCATAAGGAACAAG - UNI34278 - GATCGTCCAGCCATGCAGCTTTACCAA

CCAGGAGCTCGAAGCCGAAGCCGACTCTGTCCCGCCGATGACAGCATCAAGCCTGGAGATTCCCCAGTGGACAAAAAGCAGGAAAGTGGTATTAGCCATA

GAAAAGAAGGAGGAGAGGAGTGAGAAGTCCAAATGGTCATAGGTGTCCTGACTGTCCAGGCAGCCAAAGAGCACGTATTATGCTATCCAGAAGTGCCTTC

AGGGCAAAGGAACAGAGAACAAGAAAAGGGGTCGCTGTGCTGGTGGGATGTACTACAGAGGAGTGTGTCTAAGCAGAATAAGATTGCAGGCTCAGAACCG

AAGGACAATTTCATTGTTTTCTGCAGTTTCCACAAGTTAATTTTAATGTCTCAGAAAAAGATGGTAGCAAGAACATTGCAAGTGAAAAATGTCAAATAAG

GGCTTAACTTTGTATGACAGCTAAAAAGAGCAGGTTCGAAAATCAATGGGTGCTCTTAATCCTGGCTTGGAGCATCTTCGTTTGAGTGGAGCAGAAACAC

ACTAAGTTTCGTTGGGATCTAACTATTTTGCATTGTTGGTGTTGACTGTTGACTCTGTAGTGTAGGAGCAATGAGCATGTAATTGTAGCACAAGTAGAGC

GGAGGATAGAGCAAATTATGGCTGATGGAAAAGATTTAAATAGTCACGTTACATCTATATCCTGTGTCTGAAGTTTTCATAATTACAGCTTGTTTTAATT

CTGTAAATGTAGCATCAAAAATTCCTTGTAAACATCTCGTTTTTGCCTTTAGCGTTTTTTCCTATTACTAGGTAAAATGTAGCCCTTGGCTAGTTACTGA

C
Translation
MKEEKDHRPKEKRVTLFTPQGATGGCIGATAEGAKGDDRQDRNRDKKEALSK - UNI17576 - VVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSND

TS - UNI17576 - - UNI23953 - SLYPHMYARAYINFKNQEDILLFRDRFDGYVFLDNKG GQEYHAIVEFAPFQKAAKKKIKKRDTKVGTIED

D - UNI14812 - DPEYRKFLESYATDNEKMTSTPETLLEEIEAKNRELIA - UNI14812 - AKRTTPLLSFLKNKQ - UNI14812 - - UN

I19758 - RMREEKREERRRREIERKRQREEERRKWKEEEKRKRKDIEKLKKIERIPEREKIRDEPKIK LLRKPEKGDEKELDKRDKTKRLDKENLNE

ERASGHSYTLPRRSDVELKDEKPKR RLDDEGVRDYRDRDRDYERDQERMIRERERLKRQEEERRRQQQKERYEKEKAFKRKEEEMKREKEALRDKGKKS

ENTESICSLEKIEKKEEVVKRDRIRNK - UNI34278 - DRPAMQLYQPGARSRSRLCPADDSIKPGDSPVDKKQESGISHRKEGGEE

For any suggestions or comments, please send an email to unitrap@crg.es