Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036617 (Etl4)
Chromosomal location
Chr 2: 19831407 - 20732340 (+)
Description
enhancer trap locus 4 Gene [Source:MGI (curated);Acc:Etl4-007]
RefSeq_dna
NM_001081006 
RefSeq_peptide
NP_001074475.1 
UniGene
Mm.397986 Mm.237935 
MGI
MGI:95454 
Uniprot/SWISSPROT
A2AQ25 
Uniprot/SPTREMBL
Q3TYN4 Q8BHR1 Q3UFL8 B1AY50 B1AY49 
Human Ortholog
ENSG00000120549 (KIAA1217)
Omim not available
UniTrap UNI31095
Vector Insertion
Chr 2: 19831907 - 20038599
Public Clones IST12990B10 (tigm) IST13802A10 (tigm) IST12243D1 (tigm) IST14149E3 (tigm)
IST14566H2 (tigm) IST14159A12 (tigm) IST15083G7 (tigm) IST11565B3 (tigm)
IST10699A11 (tigm) IST12592E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33924
Vector Insertion
Chr 2: 20038681 - 20211539
Public Clones IST14331G5 (tigm) IST12358B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34866
Vector Insertion
Chr 2: 20211669 - 20261548
Public Clones IST13324G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31842
Vector Insertion
Chr 2: 20261737 - 20431673
Public Clones (sanger) IST11759H12 (tigm) IST14803H11 (tigm) IST11656A1 (tigm)
IST11534F11 (tigm) IST10785B1 (tigm) IST11107G9 (tigm) IST10427D3 (tigm)
IST10292G4 (tigm) IST13103D12 (tigm) IST10843H5 (tigm) IST11009C12 (tigm)
IST13986E2 (tigm) IST11040B8 (tigm) IST14410F9 (tigm) IST11418E11 (tigm)
IST10324H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32282
Vector Insertion
Chr 2: 20431887 - 20441454
Public Clones (sanger) IST14857H4 (tigm) IST10233A5 (tigm) IST13290H1 (tigm) IST10239F2 (tigm)
IST12544G6 (tigm) IST11973C8 (tigm) IST12987D8 (tigm) IST11830C9 (tigm)
IST10023B1 (tigm) IST11791C1 (tigm) IST13063F8 (tigm) IST11128H6 (tigm)
IST10041D3 (tigm) IST12092E4 (tigm) IST12102F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5668
Vector Insertion
Chr 2: 20441139 - 20441555
Public Clones CSI632 (baygenomics) YHB036 (baygenomics) XD075 (baygenomics) W007E11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29474
Vector Insertion
Chr 2: 20441555 - 20451585
Public Clones (sanger) P146D02 (ggtc) IST11265A6 (tigm) IST10930H8 (tigm) IST12549C6 (tigm)
IST10515C7 (tigm) IST10386E6 (tigm) IST10607H12 (tigm) IST13079C11 (tigm)
IST10037G5 (tigm) IST14662G1 (tigm) IST11070H7 (tigm) IST12964B1 (tigm)
IST12721H12 (tigm) IST12351D6 (tigm) IST12542D4 (tigm) IST12783C10 (tigm)
IST12110F1 (tigm) IST10491H1 (tigm) IST14334G4 (tigm) IST10290D7 (tigm)
IST11491G12 (tigm) IST10732H10 (tigm) IST12565E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30503
Vector Insertion
Chr 2: 20451585 - 20451870
Public Clones Ayu21-T288 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27183
Vector Insertion
Chr 2: 20451585 - 20451870
Public Clones not available
Private Clones OST67662 (lexicon) OST67660 (lexicon) OST43525 (lexicon) OST37802 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI588
Vector Insertion
Chr 2: 20451870 - 20583524
Public Clones AZ0440 (sanger) DA0059 (sanger) AE0309 (sanger) XB770 (baygenomics)
CSI740 (baygenomics) RRR119 (baygenomics) CSI486 (baygenomics) XK143 (baygenomics)
RRT259 (baygenomics) M125A01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16328
Vector Insertion
Chr 2: 20451870 - 20583524
Public Clones (sanger) 3SE286B09 (ggtc) M125A01 (ggtc) E106B04 (ggtc) D109F07 (ggtc)
M122F10 (ggtc) E057B09 (ggtc) 5SE306B05 (ggtc) E125E09 (ggtc) D145E11 (ggtc)
5SE224H01 (ggtc) E064C08 (ggtc) D077C05 (ggtc) H001A01 (ggtc) E041H02 (ggtc)
5SE286B09 (ggtc) E109B05 (ggtc) D145E05 (ggtc) 5SE311D09 (ggtc) E063C01 (ggtc)
D053B12 (ggtc) D155C03 (ggtc) PST18010-NR (escells) IST12582H10 (tigm)
IST12188B4 (tigm) IST12328A9 (tigm) IST10350F5 (tigm) IST11260B7 (tigm)
IST14924H4 (tigm) IST11543H10 (tigm) IST11185F8 (tigm) IST11003H8 (tigm)
IST11786G9 (tigm) IST11637E3 (tigm) IST10688G12 (tigm) IST12740A9 (tigm)
IST10803F2BBF1 (tigm) IST10032E1 (tigm) IST14941C8 (tigm) IST12147G9 (tigm)
IST12897F12 (tigm) IST11368F8 (tigm) IST12259H3 (tigm) IST10448A3 (tigm)
IST12758G5 (tigm) IST12870E6 (tigm) IST11526G1 (tigm) IST14844F4 (tigm)
IST10060D5 (tigm) IST11786E10 (tigm) IST12910F11 (tigm) IST10074A3 (tigm)
IST11539B2 (tigm) IST10929A9 (tigm) IST10913D3 (tigm) IST12679C11 (tigm)
IST11170G5 (tigm) IST10708A6 (tigm) IST10079D8 (tigm) IST11074F7 (tigm)
IST10302A9HMF1 (tigm) IST12294F10 (tigm) IST11785F10 (tigm) IST13106A11 (tigm)
IST10844F6 (tigm) IST14882C5 (tigm) IST12861H8 (tigm) IST11311G8 (tigm)
IST10576E12 (tigm) IST10400D7 (tigm) IST10115G10 (tigm) IST12063A5 (tigm)
IST12327D12 (tigm) IST12912F12 (tigm) IST11752H2 (tigm) IST12986H7 (tigm)
IST10468H3 (tigm) IST12294D1 (tigm) IST10827G10 (tigm) IST10961D1 (tigm)
IST12816H8 (tigm) IST14823F6 (tigm) IST10546D5 (tigm) IST10302A9BBF1 (tigm)
IST10298G9 (tigm) IST14709F9 (tigm) IST11709G11 (tigm)
Private Clones OST463101 (lexicon) OST185775 (lexicon) OST136962 (lexicon) OST119328 (lexicon)
OST40029 (lexicon) OST38263 (lexicon) OST32047 (lexicon) OST30635 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12768
Vector Insertion
Chr 2: 20583524 - 20583724
Public Clones M013A08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1514
Vector Insertion
Chr 2: 20583524 - 20583724
Public Clones CC0680 (sanger) AT0343 (sanger) AC0642 (sanger) CSG442 (baygenomics)
TEA028 (baygenomics) TEA044 (baygenomics) W064F06 (ggtc) W064E06 (ggtc)
A055F05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15271
Vector Insertion
Chr 2: 20583724 - 20631031
Public Clones (sanger) 3SE287B04 (ggtc) D072E12 (ggtc) E102B08 (ggtc) D127B05 (ggtc)
E129F10 (ggtc) E045G08 (ggtc) E120F12 (ggtc) E038D09 (ggtc) PST10209-NR (escells)
PST21883-NR (escells) IST10517C9 (tigm) IST14828F4 (tigm) IST11170F8 (tigm)
IST12564B5 (tigm) IST14729A6 (tigm) IST10763F10 (tigm) IST11565C1 (tigm)
IST13600H11 (tigm) IST13750C11 (tigm) IST12495C7 (tigm) IST10760H9 (tigm)
IST12532H2 (tigm) IST10901H3 (tigm) IST13984F10 (tigm) IST14123C12 (tigm)
IST10665B10 (tigm) IST11389A2 (tigm) IST14944E5 (tigm) IST11743G2 (tigm)
IST11122A10 (tigm) IST12279A2 (tigm) IST14026A12 (tigm) IST13109A9 (tigm)
IST12002H4 (tigm) IST10910B11 (tigm) IST13630D1 (tigm) IST12633F8 (tigm)
IST10171B3 (tigm) IST12495D7 (tigm) IST10692A11 (tigm) IST15053G3 (tigm)
IST11917A4 (tigm) IST10528G4 (tigm) IST10100F11 (tigm) IST14371H3 (tigm)
IST12719B2 (tigm) IST14466E11 (tigm) IST14769H2 (tigm) IST12875C12 (tigm)
IST11817G9 (tigm) IST14965C3 (tigm) IST10854H12 (tigm) IST13590G2 (tigm)
IST13785E8 (tigm) IST11402B5 (tigm) IST12311E2 (tigm) IST10517C9BBF1 (tigm)
IST14799H3 (tigm) IST11310A8 (tigm) IST14302D1 (tigm) IST13023E11 (tigm)
IST10056A5 (tigm) IST13140F4 (tigm) IST13776C9 (tigm) IST11141G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2242
Vector Insertion
Chr 2: 20631031 - 20631231
Public Clones AL0474 (sanger)
Private Clones OST208634 (lexicon) OST159595 (lexicon) OST124377 (lexicon) OST65012 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30032
Vector Insertion
Chr 2: 20631231 - 20634981
Public Clones D147B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37534
Vector Insertion
Chr 2: 20634981 - 20635076
Public Clones Ayu21-T493 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30556
Vector Insertion
Chr 2: 20635076 - 20644251
Public Clones IST12163A5HMR1 (tigm) IST12724C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4124
Vector Insertion
Chr 2: 20635076 - 20644251
Public Clones AN0314 (sanger) YHD460 (baygenomics) M118B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29852
Vector Insertion
Chr 2: 20644351 - 20658940
Public Clones (sanger) E045F03 (ggtc) E018G10 (ggtc) D141G11 (ggtc) IST10890F6 (tigm)
IST10890E6 (tigm) IST14912D10 (tigm) IST13683H1 (tigm) IST12032E9 (tigm)
IST10394E1 (tigm) IST11007A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29789
Vector Insertion
Chr 2: 20659183 - 20665085
Public Clones (sanger) E068C09 (ggtc) E059F07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21116
Vector Insertion
Chr 2: 20665085 - 20665919
Public Clones not available
Private Clones OST340718 (lexicon) OST207168 (lexicon) OST114931 (lexicon) OST95191 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27753
Vector Insertion
Chr 2: 20681841 - 20681892
Public Clones not available
Private Clones OST50440 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5224
Vector Insertion
Chr 2: 20681892 - 20688198
Public Clones YTC066 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8240
Vector Insertion
Chr 2: 20688071 - 20688239
Public Clones RRF024 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10426
Vector Insertion
Chr 2: 20699652 - 20699829
Public Clones D065G04 (ggtc) P022G12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114604
Sequence
TGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGA

AGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACA

GAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCT

CCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAA

CTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGT

GAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCAT

GGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTG

AAGTCAGAAGTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACC

CAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTC

CCCTCAGACCCCAGTGAATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGC

AGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCA

ATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAG

CAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAG

GCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAAC

CTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACT

CCAG GGCTCCAGCACCACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAA

ACTACAGGATCCCCGCCAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGAT

TCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATT

GCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTC

ACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGC

CTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCC

ACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGT

GTTTTCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTT

TTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGA

GAGTGAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTAC

AGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCT

TTATTACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGC

GTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCA

AGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCAC

TGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAA

CTTTTGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAA

GAGTCTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTA

TAACACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATT
Translation
 - UNI8240 - - UNI10426 -  - UNI10426 -     MSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIM

AELQ GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKKAGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPAT

KPSI
Transcript ENSMUST00000114606
Sequence
ATGCCTGTGGCAGCTTCGCTCCGAAGACCGGGTCAAAACAAACTGGTTTTCATTGGGGATCATTTTACTATCCGAGCACCCTTGTGATTTGGACTCTGAG

GAGAAGGGAAGTTGTCAGCTTTGATCATGTGAGGGCCCGAGGATTCGGATGAGGCTCTCAAACTAAGCAGTACCATAGCCCCAGGCGAGCCAATGGGCTT

GTTCACCGCCGCAATTGCACAGGTGATTTCCGCAAACAAAAA - UNI21116 - - UNI29789 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAG

ATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTC

TCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCCTGCCAGTATCCAGATCC

ATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCT

ATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCATGTCATTGCGTATCACCG

CACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCT

GATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTTAACACAC

ATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTACATCGAAAAGCCACGAAA

CACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACC

AG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAG - UNI5224 - - UNI824

0 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACC

TCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - U

NI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAG

GATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - 

TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGA

CAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTC

CTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTC

CTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCC

CTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCC

TGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATC

ACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTC

ACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGT

TCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGC

AGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCG

GAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGG

GCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAG

GAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAG

CAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG GGCTCCAGCACCACCCCACAGACAAGCCGG

ATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAGGTAGTTT

TACCTTAAACCCAATTTTGGATGGACATTATTGCAGTTAAGAAGCCAGTCGTTGACTTAGTTTCTACCAAATACTGTGTTTTCTTTGCGAGAGATTGTTT

ATGTAAACATCCTGGATCTAGGGGCATGGAAAAAGTCTAAAAGATCCTGTATTAAACTTCTCACCACCCTCTTGCATGCTTACAATAAAACATCTTTTAC

TTTGTGACTTCAGATTTTAACTGTTAACACACGGTGCCAGACCAGTGGCGGCTTCTGTGGTGAATGTAGTGTGTCATCAAATCCTCTTGGGAAACAAGAG

ACAAACCAATCTGTCGCTGATGACTACTCTTAAGTCGTCGCTACTAACATCTGTGTTGACTGCATTGCATTCGGTCACATTAACTCTCCCACACTCACAC

TCCCCACCCTTGTGACAATCCCCATGCATGGCCGGCTGGCAGTGGGGTGGGCTGTGGAATGATGATGTGCCATCTTCCTTTCTGTCGTTTCTGAACCTCC

ATTGCTATGTGCACGGGGTGGTTTCAGCCCAGTCCAGATAAAACTTAGCTCAGGCCTCCAACTGAACGTTGTTTTTCTTTTACTAAATGATGCTCAGAAG

GGCTGTGTTGCCAGCTCCTATGGGTTGATCGTGTTGCTGGCTTTCTGACAGAGTGTCTCCCACCATCTTTGTTTGCAGGCTAATGGAAGTGCTAAGAAAG

CTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAG

TGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCC

CTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATG

GCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATAC

TCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCAC

AAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCA

GAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGAT

ACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATG

TATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAAT

TGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCT

TTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGC

AAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTT

TTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCA

TTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAG

CACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAA

GCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTA

AATAAAGGGCTGCATGCTTATTA
Translation
 - UNI21116 - - UNI29789 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLP

VSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKS

RKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPK

DRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLG

SVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLE

DPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMR

AVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVV

PLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKW

EEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDV

VYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGAT

APPKEKK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQVVLP
Transcript ENSMUST00000114607
Sequence
ACAGACTGAGCTGGAAGCATCCGACAGATGGGTGGTTCTGAGGTCTCTGCGAGTCTGGAAAGTTTCTTCTAGGAAAGAACAGACCACGGAAGATGCAAG 

- UNI21116 - - UNI29789 - - UNI29852 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTG

TGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCG

TCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAA

AGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGAC

GAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTG

TAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAA

ACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACC

GGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCT

GGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - T

GAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGT

TTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATG

AGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCT

GAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTG

GAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAA

GAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAA

G GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGT

CTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCA

CAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAA

GCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTC

AGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCT

CCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGT

CCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCA

ACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATT

CTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTAC

CACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATG

TCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAA

ATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGAC

ACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATGTGAAAATGGCCCC

CAAGTGGAATCTCAAAAG GGCTCCAGCACCACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCC

AGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAGGTAGTTTTACCTTAAACCCAATTTTGGATGGACATTATTGCAGTTAAGAAGCCAGTCG

TTGACTTAGTTTCTACCAAATACTGTGTTTTCTTTGCGAGAGATTGTTTATGTAAACATCCTGGATCTAGGGGCATGGAAAAAGTCTAAAAGATCCTGTA

TTAAACTT
Translation
 - UNI21116 - - UNI29789 - - UNI29852 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPG

NATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQA

EMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVE

KQGFAYSTTTIPKDRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 -

 GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELE

ISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLK

G GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHC

STGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKN

RAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYL

PGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSR

ANSHLKDTRAGATAPPKEKK NLEFYHEDVRKSDVECENGPQVESQK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQVVLP
Transcript ENSMUST00000114609
Sequence
GGGATTTCCAGGCCATCCAGCAAGGCAAACTTAGAGGCCATGCTCAAGGTATGCCCACTTGAACTCTAGCTGAGGAAGGGCCCACCCTTGTTTTCATTAG

TGGGTAAAATTCATCCACAGAACGTTAGCTGAGAAGCACAAATAGACTTTTCAGGAACCCTTCCCATTTGGCAACCTGAAGAACACATGGGGCCTGTCTT

GGATTGCATACAG - UNI5668 - - UNI32282 - CTGCGAGTCCCGGGAAACCCAGCAGGCTGCGTCCTAGGTCAGCAGAGCCGTCACCTGTTGG

GCGGCAGAGGCGGGGACAGCCACCGCCTACAAGACACAGCCCCCAGTCCTGGCGACAGCAGGAGGGTGGCGGACGCTCCGGGACCTGGGCCGAGGAGGCC

GGGCGCTGGAATGCGGTCTTCCCGGGCGAGGGAGACTTTGCACCGGAGTGGAGACTAGTTGGGGTGGGGTTTCGCCAGTCCCCTCCGCCCCACCCCCGGG

CCCCCTTCCAAGCGCTTTCTGCGAGCTTTCCGAACTGCGCTCTGAAGTTTCCAGAGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAG

GCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC - UNI5668 - - UNI27183 - - UNI29474 - - UNI30

503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCA

GGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGG

AAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 

- - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAAC

CTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGG

CAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768

 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTC

TCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGA

GTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTA

ACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - 

ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCAT

CAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGA

CAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAA

AACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGG

ATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTC

GTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGA

ATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCG

GCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAG

CACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCA

GATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCT

GCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAG

ATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAA

CAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGG

ATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAA

AGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGT

CCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACG

ATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTC

CTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCA

CCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAAC

CAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCC

TCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGG

CAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAG

CTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAA

AGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAG

CATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCC

ACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTT

TATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG

 AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATGTGAAAATGGCCCCCAAGTGGAATCTCAAAAG GTTACTGCAGGGGCTCTGAG

ACCTAGTGGCCCCCCCAAATGGGAAAGAGTCATGGTGGATAGTATATCTGACACCTCAAGAACATCAGAATGTAGAGCTGACACCTTCACAGAGGAAAAT

GCCACACCCAATAAGAGCTTATTCAGAGACAGTAGAAATTATTCCCAGAAAAATGTGCCTAAGGTCAGTTTTTCTTCCTCTGGCCTGAACTCATTAGAAG

GTGAAATCAACAAAGGGCCTAATGTCTCGGGACTACAGTGTGCTATTCCTGACTTGGAAAATCAGAAGTTAAATTTTGGAAAGACAAAAGAGATAGGCCA

ACAGGGACAAGAAAATGCAGACAAGAGTCACATTCCTCTCCCAACTCGATCAGCAGAATTCAGTATTCATGATGTCAAAACACAAGATCAAGATGTTCCC

GTGACAGGTTATGGCCAAGTTGTCCTGAGATCGAAGGTGGGTAGGCACGCTAATATGAACATGAATGAGGATGGAGAATCAACTCCAAGTTCTCCCAGTG

AGGAACACACAGCCACTGATAACATCGCCTTTATGATCACCAAAACTGCTGTCCAGGTTCTGTCCAGCGGGGAGGTCCATGACATAGTGAGTCAAAAAGG

ACAAGATGTACAGACAGTTAATATTGATGGAAGGAAAGAGACAGCCTCTCAGCACGAAGGGACAGAAGGGGAAGAACCGGTTGTGTGCCTGGACAAGAAA

CCAGTTATTATCATTTTTGATGAACCCATGGACATCCGATCTGCATATAAAAGACTCTCAACCATCTTTGAGGAATGCGATGAGGAGCTAGAGAGAATGC

TGACAGAGGAAAAGATAGAGGAAGAGGAAGAGGATGAAAACGAAGACTCTGGAGTCCGAACCTCATCCCAAATGTCCTGTGAACAGGTCGACTCGAGAAG

TGATAGGATGGGACAAAAGGCAGAGACACAGTCACAGCCCCATGTCCTGTCAGCAGAGTTGCTAACTCCAGGAGTGCAGGGGGTTCGTAAAGCCGAGCAG

AGAAAGCTTAGCTCAGCTGATTCTCCAGACTCAGGGAATAAGTGTGGCATGGTTGATGACCAGTTTGAAAGTCCCAAGAAAAAGTTTAAGTTCAAATTCC

CTAAAAAGCAGCTTGCTGCTCTTACACAGGCAATTCGCACAGGCACCAAAACGGGAAAGAAAACCCTGCAGGTGGTTGTCTATGAGGAAGAGGAAGAGGA

CGGTACTTTGAAACAGCACAAAGAAGCCAAGCGGTTTGAAATCACCAGGTCACAGCCTGAAGATGCCCTCAAAACCATGGCTAGGAGGCAAGAGCAGCTC

AGCCCTGAGGGCACCCTTCCGGCATCAAGGACTGATGAAATTAGGAAAAGTACTTACAGAACACTGGACAGCCTGGAGCAGACCATAAAGCAACTTGAAA

ATACAATCAGTGAAATGAGCCCCAGGGCCCTAGTTGATACCTCATGTTCTTCCAACAGAGATTGTGGTGCAAGCTTGCCCCACATGGCCCAAGAGGTCTC

TCCCCGGTCCTTGCTAGTTCTGGATGAAGTACCCCCTGCCCCAGAGCCCCCCACATCCATATCTCCAGCTTCACGTAAG GGCTCCAGCACCACCCCACA

GACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGT

CAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGG

AAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAG

CAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCT

TTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGT

GCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGT

CTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATAT

TGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTG

CATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGC

TGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAAT

AAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCA

AAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCT

TCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTT

TCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCT

TAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAAT

AAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAA

TGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAG

CTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTA

ACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCT

AATAAACTCATCAACCATG
Translation
 - UNI5668 - - UNI32282 -  - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 -  - UNI588 - - UNI1514 

- - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 -  - UNI1514 - - UNI2242 - - UNI12768 - - UNI152

71 -  - UNI2242 - - UNI30032 -  - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQRE

IVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVM

FRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDL

HPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS - UNI21116 - - UNI27753 -

 SEKMVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVA

ELRLQLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC -

 UNI10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMT

DVLTMLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQ

NLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIP

NLEMPPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEE

PASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK NLEFYHEDVRKSDVECENGPQVE

SQK VTAGALRPSGPPKWERVMVDSISDTSRTSECRADTFTEENATPNKSLFRDSRNYSQKNVPKVSFSSSGLNSLEGEINKGPNVSGLQCAIPDLENQK

LNFGKTKEIGQQGQENADKSHIPLPTRSAEFSIHDVKTQDQDVPVTGYGQVVLRSKVGRHANMNMNEDGESTPSSPSEEHTATDNIAFMITKTAVQVLSS

GEVHDIVSQKGQDVQTVNIDGRKETASQHEGTEGEEPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEECDEELERMLTEEKIEEEEEDENEDSGVRTSS

QMSCEQVDSRSDRMGQKAETQSQPHVLSAELLTPGVQGVRKAEQRKLSSADSPDSGNKCGMVDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTL

QVVVYEEEEEDGTLKQHKEAKRFEITRSQPEDALKTMARRQEQLSPEGTLPASRTDEIRKSTYRTLDSLEQTIKQLENTISEMSPRALVDTSCSSNRDCG

ASLPHMAQEVSPRSLLVLDEVPPAPEPPTSISPASRK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKKAGGDCKPTSPSLP

ASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGHHHLSFALQTQNGRAAPTTSSSSSP

PSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114608
Sequence
ATGCCTGTGGCAGCTTCGCTCCGAAGACCGGGTCAAAACAAACTGGTTTTCATTGGGGATCATTTTACTATCCGAGCACCCTTGTGATTTGGACTCTGAG

GAGAAGGGAAGTTGTCAGCTTTGATCATGTGAGGGCCCGAGGATTCGGATGAGGCTCTCAAACTAAGCAGTACCATAGCCCCAGGCGAGCCAATGGGCTT

GTTCACCGCCGCAATTGCACAGGTGATTTCCGCAAACAAAAA - UNI21116 - - UNI29789 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAG

ATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTC

TCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCCTGCCAGTATCCAGATCC

ATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCT

ATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCATGTCATTGCGTATCACCG

CACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCT

GATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTTAACACAC

ATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTACATCGAAAAGCCACGAAA

CACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACC

AG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAG - UNI5224 - - UNI824

0 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACC

TCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - U

NI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAG

GATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - 

TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGA

CAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTC

CTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTC

CTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCC

CTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCC

TGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATC

ACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTC

ACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGT

TCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGC

AGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCG

GAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGG

GCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAG

GAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAG

CAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG AATTTGGAATTTTACCACGAAGATGTACGA

AAATCTGATGTTGAATGTGAAAATGGCCCCCAAGTGGAATCTCAAAAG GTTACTGCAGGGGCTCTGAGACCTAGTGGCCCCCCCAAATGGGAAAGAGTC

ATGGTGGATAGTATATCTGACACCTCAAGAACATCAGAATGTAGAGCTGACACCTTCACAGAGGAAAATGCCACACCCAATAAGAGCTTATTCAGAGACA

GTAGAAATTATTCCCAGAAAAATGTGCCTAAGGTCAGTTTTTCTTCCTCTGGCCTGAACTCATTAGAAGGTGAAATCAACAAAGGGCCTAATGTCTCGGG

ACTACAGTGTGCTATTCCTGACTTGGAAAATCAGAAGTTAAATTTTGGAAAGACAAAAGAGATAGGCCAACAGGGACAAGAAAATGCAGACAAGAGTCAC

ATTCCTCTCCCAACTCGATCAGCAGAATTCAGTATTCATGATGTCAAAACACAAGATCAAGATGTTCCCGTGACAGGTTATGGCCAAGTTGTCCTGAGAT

CGAAGGTGGGTAGGCACGCTAATATGAACATGAATGAGGATGGAGAATCAACTCCAAGTTCTCCCAGTGAGGAACACACAGCCACTGATAACATCGCCTT

TATGATCACCAAAACTGCTGTCCAGGTTCTGTCCAGCGGGGAGGTCCATGACATAGTGAGTCAAAAAGGACAAGATGTACAGACAGTTAATATTGATGGA

AGGAAAGAGACAGCCTCTCAGCACGAAGGGACAGAAGGGGAAGAACCGGTTGTGTGCCTGGACAAGAAACCAGTTATTATCATTTTTGATGAACCCATGG

ACATCCGATCTGCATATAAAAGACTCTCAACCATCTTTGAGGAATGCGATGAGGAGCTAGAGAGAATGCTGACAGAGGAAAAGATAGAGGAAGAGGAAGA

GGATGAAAACGAAGACTCTGGAGTCCGAACCTCATCCCAAATGTCCTGTGAACAGGTCGACTCGAGAAGTGATAGGATGGGACAAAAGGCAGAGACACAG

TCACAGCCCCATGTCCTGTCAGCAGAGTTGCTAACTCCAGGAGTGCAGGGGGTTCGTAAAGCCGAGCAGAGAAAGCTTAGCTCAGCTGATTCTCCAGACT

CAGGGAATAAGTGTGGCATGGTTGATGACCAGTTTGAAAGTCCCAAGAAAAAGTTTAAGTTCAAATTCCCTAAAAAGCAGCTTGCTGCTCTTACACAGGC

AATTCGCACAGGCACCAAAACGGGAAAGAAAACCCTGCAGGTGGTTGTCTATGAGGAAGAGGAAGAGGACGGTACTTTGAAACAGCACAAAGAAGCCAAG

CGGTTTGAAATCACCAGGTCACAGCCTGAAGATGCCCTCAAAACCATGGCTAGGAGGCAAGAGCAGCTCAGCCCTGAGGGCACCCTTCCGGCATCAAGGA

CTGATGAAATTAGGAAAAGTACTTACAGAACACTGGACAGCCTGGAGCAGACCATAAAGCAACTTGAAAATACAATCAGTGAAATGAGCCCCAGGGCCCT

AGTTGATACCTCATGTTCTTCCAACAGAGATTGTGGTGCAAGCTTGCCCCACATGGCCCAAGAGGTCTCTCCCCGGTCCTTGCTAGTTCTGGATGAAGTA

CCCCCTGCCCCAGAGCCCCCCACATCCATATCTCCAGCTTCACGTAAG GGCTCCAGCACCACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCC

AAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGT

GGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGG

ACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCAT

CCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGA

GCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTA

GCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGT

GGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTA

TGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTA

TTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGA

TTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAA

AGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTT

GCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAAC

TCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTT

TAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTG

GATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAGCACAT

AGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAAC

AAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAA

AGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGC

ATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCTAATAAACTCATCAACCATGTGGCCGTCTGGA

CTTCCTTTCCTGCCTGACTCTTCTCTAGGGCATGGGGGAGGGGGCGTGGCTAACAGAGAACCCTGCACACAGGTTTGCACACTCATCCATTGCAGCAGCT

TTGCTGCTTGCTTGGTTTTGTTTTTGTTTTTAGTTTCTATTAAAAGTAAAAAATAAAATAAAAAAGTGTATTTATCA
Translation
 - UNI21116 - - UNI29789 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLP

VSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKS

RKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPK

DRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLG

SVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLE

DPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMR

AVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVV

PLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKW

EEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDV

VYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGAT

APPKEKK NLEFYHEDVRKSDVECENGPQVESQK VTAGALRPSGPPKWERVMVDSISDTSRTSECRADTFTEENATPNKSLFRDSRNYSQKNVPKVSFS

SSGLNSLEGEINKGPNVSGLQCAIPDLENQKLNFGKTKEIGQQGQENADKSHIPLPTRSAEFSIHDVKTQDQDVPVTGYGQVVLRSKVGRHANMNMNEDG

ESTPSSPSEEHTATDNIAFMITKTAVQVLSSGEVHDIVSQKGQDVQTVNIDGRKETASQHEGTEGEEPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEE

CDEELERMLTEEKIEEEEEDENEDSGVRTSSQMSCEQVDSRSDRMGQKAETQSQPHVLSAELLTPGVQGVRKAEQRKLSSADSPDSGNKCGMVDDQFESP

KKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVVYEEEEEDGTLKQHKEAKRFEITRSQPEDALKTMARRQEQLSPEGTLPASRTDEIRKSTYRTLDSL

EQTIKQLENTISEMSPRALVDTSCSSNRDCGASLPHMAQEVSPRSLLVLDEVPPAPEPPTSISPASRK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQS

KLQDPRQYRQ ANGSAKKAGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSP

PHAGKGHHHLSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114610
Sequence
AGTCCGGAGGAGAGCGACGGGAGAGGGCTGTGCGCTCCTTGCTAAGGATGCTGGAGGCGCACTCGGGCAGCCACCGCTCCCGCGCTCCTCCCTGTCACGA

TGCGCGCCCGCGGAGGAGCCTCGCCAACCTCCAGGTGACTTGAAAGTCGTCTCCCCAGGAGGACGGAGAGGGTGCTGCAGTCCTGGCATGCACTAAAACT

GCAAGTCGGACAGAAACAGCCCAGTCGAAGAGCGAGGCACACGGGGCGCAGTGCCCCAGCACAGCATCCCAGGGCTGCTAAAGGTAGCGGAGGCTCAAGC

TTGCAATAAGATCTCCGTGCTGGACCCGGACACAGGGCACTCTTGCCACCGAAAGACTCATTTTTCCCTTCTTGCGCATTTCGCAGTCGTAGCTGGCCTG

GGGAATGCGAGCATGGTGGAGGCTTCCTTCGGGTCGCCCAGAAGCAGCTGCCAGTGGGAGAGCTAGCGGAGAGGAGCGGGGGCGGCAGCCTCGGCCCGAA

 - UNI31095 - GTTTCGTCCCCTGGACCCTGTGTTTGACATCTTCAATCCATGAGCAAAACTCTTTCCAGAGCAAGAAATACTGACTATGGG - UN

I33924 - ATGGAAATACTGGGATCCTAAGTTTGTAACTGACCATACCATACTCCAGAGACAAAGGTGGAACTGCAGCCCAGGACCCCTGAAAGTCGCC

CTCAAAGGATTATACTACTTATATGTCACTCTGTCCTCCACCCTGTTGTCTTCTTAG - UNI5668 - - UNI27183 - - UNI29474 - - UN

I30503 - - UNI31842 - - UNI32282 - - UNI34867 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCG

CAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCAGGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGT

TCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGGAAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCA

TCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI

30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAACCTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGA

AGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGGCAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGA

TCCCTGG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGC

GGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTCTCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGT

TGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGAGTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGAT

CCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTAACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116

 - - UNI29789 - - UNI29852 - - UNI30556 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGAT

CTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAG

CCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTG

GAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAG

GACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTA

CTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCC

AAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAG

ACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGA

CCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACCAGGTAAGACAAAGGGGTGGCTGAGGAT

GGTTTGTCCTGGTGTGTTGCTGAAAGCTGTTTTCTAGATACCAAGCCAGAAAACACAATTCTGAGTATCAGGGAAGACTAACCTTCCCTGAAGAGTTCCT

GGATGAGTGGGTTCAGGTAAATGAGGTCCACCAGTGACCATGTGAAAGGAGACAGAGGAATAACAAAGGCCACCAGCCCTACCTGTCCCTAGACTCTGGT

CCTTACAGAATTGTCATTAAGGTAACTTGGAACTATTGGGAAGAAAATGGTGATTGATGGAAACCACGCAGATAGCAGATGGAAGAATCATAATTGCCTG

CCATAGAAAATGAAGACTAGCCTAACTGTTGGTCACCGCCATCTGTGTTCCTGCCTATACAATGCAGTTTCAATTTCTCATCTGGTTTTGTGAGATGAAA

AGAATGAGTTTGCATGATATTGGATGGTTGGGTTTAATACTCATTCAGGAGTGGAGTTGGAATAGGTAGAGTTTTTGAGTGAATAAAATACTCTGAAATG

Translation
 - UNI31095 -  - UNI33924 -  - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 - - UNI31842 - - UNI32

282 - - UNI34867 - MQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - UNI588 - - UNI1514 - - UNI12768 - - UNI1

6328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLG

 - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGDETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVA

IYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMR - UNI4124 - - UNI21116 

- - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIP

GNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQ

AEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLV

EKQGFAYSTTTIPKDRETR
Transcript ENSMUST00000066509
Sequence
AGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAGGCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC

 - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCAT

GCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCAGGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCG

AAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGGAAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACA

GCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - -

 UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAACCTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTT

TGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGGCAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGA

AAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAG

CTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTCTCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCA

GTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGAGTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGAC

AGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTAACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI2

1116 - - UNI29789 - - UNI29852 - - UNI30556 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCA

GGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGG

GCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCAT

TTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCAT

GAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTG

CTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGG

CTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAG

CCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTG

TAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - AGAGAGG

ATGCAAGCCATGGAGAAGCAGATTGCCAGTCTAACTGGCCTTGTTCAGTCTGCGCTTTTTAAAGGGCCCATTACAAGTAGTAGCAAAGAGGCGTCTAG -

 UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - 

GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAG

CCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGA

ACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCA

GCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTG

TTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGT

GGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACA

CAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGC

ATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCAC

TGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTT

CCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTC

TGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAG

AACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAG

GAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGC

TGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTG

GATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTA

GAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGA

AGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAG

CCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATG

TGAAAATGGCCCCCAAGTGGAATCTCAAAAG GTTACTGCAGGGGCTCTGAGACCTAGTGGCCCCCCCAAATGGGAAAGAGTCATGGTGGATAGTATATC

TGACACCTCAAGAACATCAGAATGTAGAGCTGACACCTTCACAGAGGAAAATGCCACACCCAATAAGAGCTTATTCAGAGACAGTAGAAATTATTCCCAG

AAAAATGTGCCTAAGGTCAGTTTTTCTTCCTCTGGCCTGAACTCATTAGAAGGTGAAATCAACAAAGGGCCTAATGTCTCGGGACTACAGTGTGCTATTC

CTGACTTGGAAAATCAGAAGTTAAATTTTGGAAAGACAAAAGAGATAGGCCAACAGGGACAAGAAAATGCAGACAAGAGTCACATTCCTCTCCCAACTCG

ATCAGCAGAATTCAGTATTCATGATGTCAAAACACAAGATCAAGATGTTCCCGTGACAGGTTATGGCCAAGTTGTCCTGAGATCGAAGGTGGGTAGGCAC

GCTAATATGAACATGAATGAGGATGGAGAATCAACTCCAAGTTCTCCCAGTGAGGAACACACAGCCACTGATAACATCGCCTTTATGATCACCAAAACTG

CTGTCCAGGTTCTGTCCAGCGGGGAGGTCCATGACATAGTGAGTCAAAAAGGACAAGATGTACAGACAGTTAATATTGATGGAAGGAAAGAGACAGCCTC

TCAGCACGAAGGGACAGAAGGGGAAGAACCGGTTGTGTGCCTGGACAAGAAACCAGTTATTATCATTTTTGATGAACCCATGGACATCCGATCTGCATAT

AAAAGACTCTCAACCATCTTTGAGGAATGCGATGAGGAGCTAGAGAGAATGCTGACAGAGGAAAAGATAGAGGAAGAGGAAGAGGATGAAAACGAAGACT

CTGGAGTCCGAACCTCATCCCAAATGTCCTGTGAACAGGTCGACTCGAGAAGTGATAGGATGGGACAAAAGGCAGAGACACAGTCACAGCCCCATGTCCT

GTCAGCAGAGTTGCTAACTCCAGGAGTGCAGGGGGTTCGTAAAGCCGAGCAGAGAAAGCTTAGCTCAGCTGATTCTCCAGACTCAGGGAATAAGTGTGGC

ATGGTTGATGACCAGTTTGAAAGTCCCAAGAAAAAGTTTAAGTTCAAATTCCCTAAAAAGCAGCTTGCTGCTCTTACACAGGCAATTCGCACAGGCACCA

AAACGGGAAAGAAAACCCTGCAGGTGGTTGTCTATGAGGAAGAGGAAGAGGACGGTACTTTGAAACAGCACAAAGAAGCCAAGCGGTTTGAAATCACCAG

GTCACAGCCTGAAGATGCCCTCAAAACCATGGCTAGGAGGCAAGAGCAGCTCAGCCCTGAGGGCACCCTTCCGGCATCAAGGACTGATGAAATTAGGAAA

AGTACTTACAGAACACTGGACAGCCTGGAGCAGACCATAAAGCAACTTGAAAATACAATCAGTGAAATGAGCCCCAGGGCCCTAGTTGATACCTCATGTT

CTTCCAACAGAGATTGTGGTGCAAGCTTGCCCCACATGGCCCAAGAGGTCTCTCCCCGGTCCTTGCTAGTTCTGGATGAAGTACCCCCTGCCCCAGAGCC

CCCCACATCCATATCTCCAGCTTCACGTAAG GGCTCCAGCACCACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAG

CCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTAC

TTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCC

AATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATG

GCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTC

TTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAA

GCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTT

TTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGT

TGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCAT

GTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTAT

GTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATAT

TTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATA

CTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAA

AAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTG

AGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACAC

TTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACA

CCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGG

GTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATT

ATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTA

ATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCTAATAAACTCATCAACCATGTGGCCGTCTGGA
Translation
MEESEGQKCEPNLPPSGDSRQMPQ - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 - QQGRSNLHVTSQEDAACRRPRERL

SNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - UNI588 - - UNI1514 - - UNI

12768 - - UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPFARGSRTRASLP

VVRSANQTKERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGDETKQLRMPNEVTSTDTIRALFVSAFP

QQLTMKMLESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMR - UNI4124

 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSP

SRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRT

AIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNT

SGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETR - UNI21116 - RERMQAMEKQIASLTGLVQSALFKGPITSSSKEASS - UNI27753 - SEK

MVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRL

QLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI

10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLT

MLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPG

GTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEM

PPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASA

WAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK NLEFYHEDVRKSDVECENGPQVESQK 

VTAGALRPSGPPKWERVMVDSISDTSRTSECRADTFTEENATPNKSLFRDSRNYSQKNVPKVSFSSSGLNSLEGEINKGPNVSGLQCAIPDLENQKLNFG

KTKEIGQQGQENADKSHIPLPTRSAEFSIHDVKTQDQDVPVTGYGQVVLRSKVGRHANMNMNEDGESTPSSPSEEHTATDNIAFMITKTAVQVLSSGEVH

DIVSQKGQDVQTVNIDGRKETASQHEGTEGEEPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEECDEELERMLTEEKIEEEEEDENEDSGVRTSSQMSC

EQVDSRSDRMGQKAETQSQPHVLSAELLTPGVQGVRKAEQRKLSSADSPDSGNKCGMVDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVV

YEEEEEDGTLKQHKEAKRFEITRSQPEDALKTMARRQEQLSPEGTLPASRTDEIRKSTYRTLDSLEQTIKQLENTISEMSPRALVDTSCSSNRDCGASLP

HMAQEVSPRSLLVLDEVPPAPEPPTSISPASRK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKKAGGDCKPTSPSLPASKI

PALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGHHHLSFALQTQNGRAAPTTSSSSSPPSPA

SPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114614
Sequence
GGGATTTCCAGGCCATCCAGCAAGGCAAACTTAGAGGCCATGCTCAAGGTATGCCCACTTGAACTCTAGCTGAGGAAGGGCCCACCCTTGTTTTCATTAG

TGGGTAAAATTCATCCACAGAACGTTAGCTGAGAAGCACAAATAGACTTTTCAGGAACCCTTCCCATTTGGCAACCTGAAGAACACATGGGGCCTGTCTT

GGATTGCATACAG - UNI5668 - - UNI32282 - CTGCGAGTCCCGGGAAACCCAGCAGGCTGCGTCCTAGGTCAGCAGAGCCGTCACCTGTTGG

GCGGCAGAGGCGGGGACAGCCACCGCCTACAAGACACAGCCCCCAGTCCTGGCGACAGCAGGAGGGTGGCGGACGCTCCGGGACCTGGGCCGAGGAGGCC

GGGCGCTGGAATGCGGTCTTCCCGGGCGAGGGAGACTTTGCACCGGAGTGGAGACTAGTTGGGGTGGGGTTTCGCCAGTCCCCTCCGCCCCACCCCCGGG

CCCCCTTCCAAGCGCTTTCTGCGAGCTTTCCGAACTGCGCTCTGAAGTTTCCAGAGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAG

GCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC - UNI5668 - - UNI27183 - - UNI29474 - - UNI30

503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCA

GGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGG

AAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 

- - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAAC

CTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGG

CAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768

 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTC

TCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGA

GTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTA

ACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - 

ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCAT

CAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGA

CAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAA

AACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGG

ATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTC

GTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGA

ATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCG

GCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAG

CACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCA

GATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCT

GCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAG

ATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAA

CAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGG

ATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAA

AGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGT

CCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACG

ATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTC

CTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCA

CCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAAC

CAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCC

TCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGT AAGGCAGAAAAGAAATGGGAAGAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTC

GAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAG

GGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGA

GAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGC

CAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGA

GGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCA

GTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG GGCTCCAGCACCACCCCACAGACAAGCCGGAT

GCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAG GCTAATGG

AAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCT

CTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCG

CTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACT

GCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATC

AGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAG

ATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATATTGCTGTATCGTT

CAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTAC

TGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGCTGACTGTACTAT

GCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGC

GTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCAAAACTTCATGGT

TCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTA

GAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTT

CTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAA

TTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAATAAACATCAAAAT

ACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAATGGGACTATCCA

TACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAGCTATAAGCAGAG

ACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTAACTATTGCCACA

GGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCTAATAAACTCATC

AACCATG
Translation
 - UNI5668 - - UNI32282 - MEESEGQKCEPNLPPSGDSRQMPQ - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 

- QQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - 

UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSG

DSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGD

ETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDP

SHAFNHMTKAVNGDMR - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPG

SVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHE

GRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQP

DRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQA

DGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ -

 UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CEL

EDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDG

LLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPA

ITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHS KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAGDKLELSE 

EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEE

GDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKK

AGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGHHHLSFALQTQN

GRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000045555
Sequence
GGGATTTCCAGGCCATCCAGCAAGGCAAACTTAGAGGCCATGCTCAAGGTATGCCCACTTGAACTCTAGCTGAGGAAGGGCCCACCCTTGTTTTCATTAG

TGGGTAAAATTCATCCACAGAACGTTAGCTGAGAAGCACAAATAGACTTTTCAGGAACCCTTCCCATTTGGCAACCTGAAGAACACATGGGGCCTGTCTT

GGATTGCATACAG - UNI5668 - - UNI32282 - CTGCGAGTCCCGGGAAACCCAGCAGGCTGCGTCCTAGGTCAGCAGAGCCGTCACCTGTTGG

GCGGCAGAGGCGGGGACAGCCACCGCCTACAAGACACAGCCCCCAGTCCTGGCGACAGCAGGAGGGTGGCGGACGCTCCGGGACCTGGGCCGAGGAGGCC

GGGCGCTGGAATGCGGTCTTCCCGGGCGAGGGAGACTTTGCACCGGAGTGGAGACTAGTTGGGGTGGGGTTTCGCCAGTCCCCTCCGCCCCACCCCCGGG

CCCCCTTCCAAGCGCTTTCTGCGAGCTTTCCGAACTGCGCTCTGAAGTTTCCAGAGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAG

GCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC - UNI5668 - - UNI27183 - - UNI29474 - - UNI30

503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCA

GGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGG

AAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 

- - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAAC

CTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGG

CAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768

 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTC

TCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGA

GTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTA

ACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - 

ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCAT

CAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGA

CAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAA

AACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGG

ATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTC

GTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGA

ATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCG

GCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAG

CACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCA

GATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCT

GCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAG

ATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAA

CAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGG

ATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAA

AGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGT

CCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACG

ATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTC

CTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCA

CCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAAC

CAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCC

TCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGG

CAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAG

CTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAA

AGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAG

CATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCC

ACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTT

TATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG

 GGCTCCAGCACCACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTA

CAGGATCCCCGCCAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCA

GCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTT

CTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGC

AGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCC

CCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCC

CATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTT

TCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCC

ACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGT

GAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAG

ACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTAT

TACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGC

TAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCC

AGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTC

TGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTT

TGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGT

CTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAAC

ACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGT

CTTTCAGTCAACGAATATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTC

GAAAGGGAAGGATGAATTCCTAATAAACTCATCAACCATG
Translation
 - UNI5668 - - UNI32282 - MEESEGQKCEPNLPPSGDSRQMPQ - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 

- QQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - 

UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSG

DSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGD

ETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDP

SHAFNHMTKAVNGDMR - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPG

SVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHE

GRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQP

DRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQA

DGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ -

 UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CEL

EDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDG

LLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPA

ITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGD

AAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAP

SSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQ

YRQ ANGSAKKAGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGH

HHLSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114619
Sequence
GGGATTTCCAGGCCATCCAGCAAGGCAAACTTAGAGGCCATGCTCAAGGTATGCCCACTTGAACTCTAGCTGAGGAAGGGCCCACCCTTGTTTTCATTAG

TGGGTAAAATTCATCCACAGAACGTTAGCTGAGAAGCACAAATAGACTTTTCAGGAACCCTTCCCATTTGGCAACCTGAAGAACACATGGGGCCTGTCTT

GGATTGCATACAG - UNI5668 - - UNI32282 - CTGCGAGTCCCGGGAAACCCAGCAGGCTGCGTCCTAGGTCAGCAGAGCCGTCACCTGTTGG

GCGGCAGAGGCGGGGACAGCCACCGCCTACAAGACACAGCCCCCAGTCCTGGCGACAGCAGGAGGGTGGCGGACGCTCCGGGACCTGGGCCGAGGAGGCC

GGGCGCTGGAATGCGGTCTTCCCGGGCGAGGGAGACTTTGCACCGGAGTGGAGACTAGTTGGGGTGGGGTTTCGCCAGTCCCCTCCGCCCCACCCCCGGG

CCCCCTTCCAAGCGCTTTCTGCGAGCTTTCCGAACTGCGCTCTGAAGTTTCCAGAGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAG

GCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC - UNI5668 - - UNI27183 - - UNI29474 - - UNI30

503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCA

GGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGG

AAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 

- - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAAC

CTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGG

CAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768

 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTC

TCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGA

GTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTA

ACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - 

ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCAT

CAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGA

CAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAA

AACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGG

ATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTC

GTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGA

ATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCG

GCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAG

CACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCA

GATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCT

GCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAG

ATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAA

CAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGG

ATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAA

AGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGT

CCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACG

ATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTC

CTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCA

CCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAAC

CAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAATGGTTCC

TCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAAAAAAGG

CAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGCCCCCAG

CTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAA

AGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGGCAGGAG

CATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCC

ACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTGTTCCTT

TATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAG

 AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATGTGAAAATGGCCCCCAAGTGGAATCTCAAAAG GGCTCCAGCACCACCCCACA

GACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGT

CAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGG

AAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAG

CAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCT

TTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGT

GCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGT

CTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATAT

TGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTG

CATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGC

TGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAAT

AAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCA

AAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCT

TCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTT

TCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCT

TAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAAT

AAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAA

TGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAG

CTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTA

ACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCT

AATAAACTCATCAACCATG
Translation
 - UNI5668 - - UNI32282 - MEESEGQKCEPNLPPSGDSRQMPQ - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 

- QQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - 

UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSG

DSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGD

ETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDP

SHAFNHMTKAVNGDMR - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPG

SVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHE

GRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQP

DRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETS - UNI21116 - - UNI27753 - SEKMVKATANRNQA

DGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ -

 UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - CEL

EDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDG

LLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPA

ITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGD

AAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAP

SSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK NLEFYHEDVRKSDVECENGPQVESQK GSSTTPQTSRM

PVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKKAGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRS

AHSASLIPSVSNGSLKFQSPPHAGKGHHHLSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114620
Sequence
GGGATTTCCAGGCCATCCAGCAAGGCAAACTTAGAGGCCATGCTCAAGGTATGCCCACTTGAACTCTAGCTGAGGAAGGGCCCACCCTTGTTTTCATTAG

TGGGTAAAATTCATCCACAGAACGTTAGCTGAGAAGCACAAATAGACTTTTCAGGAACCCTTCCCATTTGGCAACCTGAAGAACACATGGGGCCTGTCTT

GGATTGCATACAG - UNI5668 - - UNI32282 - CTGCGAGTCCCGGGAAACCCAGCAGGCTGCGTCCTAGGTCAGCAGAGCCGTCACCTGTTGG

GCGGCAGAGGCGGGGACAGCCACCGCCTACAAGACACAGCCCCCAGTCCTGGCGACAGCAGGAGGGTGGCGGACGCTCCGGGACCTGGGCCGAGGAGGCC

GGGCGCTGGAATGCGGTCTTCCCGGGCGAGGGAGACTTTGCACCGGAGTGGAGACTAGTTGGGGTGGGGTTTCGCCAGTCCCCTCCGCCCCACCCCCGGG

CCCCCTTCCAAGCGCTTTCTGCGAGCTTTCCGAACTGCGCTCTGAAGTTTCCAGAGGGAGAAGCCCGGCCGGCCGGCAGGGACAATGGAAGAAAGCGAAG

GCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC - UNI5668 - - UNI27183 - - UNI29474 - - UNI30

503 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCA

GGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGG

AAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 

- - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAAC

CTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGG

CAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768

 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTC

TCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGA

GTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTA

ACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - 

ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCAT

CAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGA

CAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAA

AACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGG

ATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTC

GTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGA

ATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCG

GCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAG

CACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - AGAGAGGATGCAAGCCATGGAGAAGCAGATTGCCAGTCTAACTGGCCTTGTTC

AGTCTGCGCTTTTTAAAGGGCCCATTACAAGTAGTAGCAAAGAGGCGTCTAG - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAAC

CAAGCAGATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTT

CTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTC

CAGCAGATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAAT

CAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAA

GAGCGGATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGAC

CCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCG

TGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTC

TTGACGATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCA

GAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCC

TATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGG

AGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTGAAT

GGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAAGAA

AAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGATGC

CCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAG

GGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACACTGG

CAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCC

ATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAAGTG

TTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAGGAG

AAGAAG AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATGTGAAAATGGCCCCCAAGTGGAATCTCAAAAG GTTACTGCAGGGGC

TCTGAGACCTAGTGGCCCCCCCAAATGGGAAAGAGTCATGGTGGATAGTATATCTGACACCTCAAGAACATCAGAATGTAGAGCTGACACCTTCACAGAG

GAAAATGCCACACCCAATAAGAGCTTATTCAGAGACAGTAGAAATTATTCCCAGAAAAATGTGCCTAAGGTCAGTTTTTCTTCCTCTGGCCTGAACTCAT

TAGAAGGTGAAATCAACAAAGGGCCTAATGTCTCGGGACTACAGTGTGCTATTCCTGACTTGGAAAATCAGAAGTTAAATTTTGGAAAGACAAAAGAGAT

AGGCCAACAGGGACAAGAAAATGCAGACAAGAGTCACATTCCTCTCCCAACTCGATCAGCAGAATTCAGTATTCATGATGTCAAAACACAAGATCAAGAT

GTTCCCGTGACAGGTTATGGCCAAGTTGTCCTGAGATCGAAGGTGGGTAGGCACGCTAATATGAACATGAATGAGGATGGAGAATCAACTCCAAGTTCTC

CCAGTGAGGAACACACAGCCACTGATAACATCGCCTTTATGATCACCAAAACTGCTGTCCAGGTTCTGTCCAGCGGGGAGGTCCATGACATAGTGAGTCA

AAAAGGACAAGATGTACAGACAGTTAATATTGATGGAAGGAAAGAGACAGCCTCTCAGCACGAAGGGACAGAAGGGGAAGAACCGGTTGTGTGCCTGGAC

AAGAAACCAGTTATTATCATTTTTGATGAACCCATGGACATCCGATCTGCATATAAAAGACTCTCAACCATCTTTGAGGAATGCGATGAGGAGCTAGAGA

GAATGCTGACAGAGGAAAAGATAGAGGAAGAGGAAGAGGATGAAAACGAAGACTCTGGAGTCCGAACCTCATCCCAAATGTCCTGTGAACAGGTCGACTC

GAGAAGTGATAGGATGGGACAAAAGGCAGAGACACAGTCACAGCCCCATGTCCTGTCAGCAGAGTTGCTAACTCCAGGAGTGCAGGGGGTTCGTAAAGCC

GAGCAGAGAAAGCTTAGCTCAGCTGATTCTCCAGACTCAGGGAATAAGTGTGGCATGGTTGATGACCAGTTTGAAAGTCCCAAGAAAAAGTTTAAGTTCA

AATTCCCTAAAAAGCAGCTTGCTGCTCTTACACAGGCAATTCGCACAGGCACCAAAACGGGAAAGAAAACCCTGCAGGTGGTTGTCTATGAGGAAGAGGA

AGAGGACGGTACTTTGAAACAGCACAAAGAAGCCAAGCGGTTTGAAATCACCAGGTCACAGCCTGAAGATGCCCTCAAAACCATGGCTAGGAGGCAAGAG

CAGCTCAGCCCTGAGGGCACCCTTCCGGCATCAAGGACTGATGAAATTAGGAAAAGTACTTACAGAACACTGGACAGCCTGGAGCAGACCATAAAGCAAC

TTGAAAATACAATCAGTGAAATGAGCCCCAGGGCCCTAGTTGATACCTCATGTTCTTCCAACAGAGATTGTGGTGCAAGCTTGCCCCACATGGCCCAAGA

GGTCTCTCCCCGGTCCTTGCTAGTTCTGGATGAAGTACCCCCTGCCCCAGAGCCCCCCACATCCATATCTCCAGCTTCACGTAAG GGCTCCAGCACCAC

CCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAA

TACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGC

TCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCC

CCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCA

TCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAAT

CAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAG

AAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTA

TCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTG

TAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAG

ACAAGCTGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAG

AGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTT

TTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAA

TGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCT

TTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATG

TTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAAT

ATAAATAAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGG

CAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACAT

ATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAA

TATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGA

ATTCCTAATAAACTCATCAACCATG
Translation
 - UNI5668 - - UNI32282 - MEESEGQKCEPNLPPSGDSRQMPQ - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 

- QQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - 

UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSG

DSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGD

ETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDP

SHAFNHMTKAVNGDMR - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPG

SVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHE

GRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQP

DRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRETR - UNI21116 - RERMQAMEKQIASLTGLVQSALFKGPI

TSSSKEASS - UNI27753 - SEKMVKATANRNQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPS

QPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQLQ - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTL

VEQERQKYLHEEERIVKKLC - UNI10426 - CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEA

VRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHH

VQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEH

YNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK

 VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK N

LEFYHEDVRKSDVECENGPQVESQK VTAGALRPSGPPKWERVMVDSISDTSRTSECRADTFTEENATPNKSLFRDSRNYSQKNVPKVSFSSSGLNSLEG

EINKGPNVSGLQCAIPDLENQKLNFGKTKEIGQQGQENADKSHIPLPTRSAEFSIHDVKTQDQDVPVTGYGQVVLRSKVGRHANMNMNEDGESTPSSPSE

EHTATDNIAFMITKTAVQVLSSGEVHDIVSQKGQDVQTVNIDGRKETASQHEGTEGEEPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEECDEELERML

TEEKIEEEEEDENEDSGVRTSSQMSCEQVDSRSDRMGQKAETQSQPHVLSAELLTPGVQGVRKAEQRKLSSADSPDSGNKCGMVDDQFESPKKKFKFKFP

KKQLAALTQAIRTGTKTGKKTLQVVVYEEEEEDGTLKQHKEAKRFEITRSQPEDALKTMARRQEQLSPEGTLPASRTDEIRKSTYRTLDSLEQTIKQLEN

TISEMSPRALVDTSCSSNRDCGASLPHMAQEVSPRSLLVLDEVPPAPEPPTSISPASRK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYR

Q ANGSAKKAGGDCKPTSPSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGHHH

LSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS
Transcript ENSMUST00000114624
Sequence
ATGTCTAAATCCTCCCGCTCGGCTAGATCCTTCTTTACAAACGCAGCTGCTAAGTTGCCGTCCTCTAAGAAGGATGATTTAAGCAGCAAGCAGAAGAAAA

CCAGCCGAGGTGACAAGACAGAGAGAATTGGAAGCGAAGGAAACTTGACAGAGTATCAGCAGGTGCAGGCTGCAGCAACTTCAGCTCAGAGGAAGGCAGC

GGCGGCTCACAAAG - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 - - UNI31842 - - UNI32282 - AACAAGGG

AGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGCTCAGGTTTCCAAGCCTG

CCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGGAAGAGAGAGGCGTT

CCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI588 - - UNI1514 - 

- UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAACCTCCCAATTTGGGG

GATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGGCAGTCGTACTCGCG

CGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 

- GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAGCTCTCTTCGTCAGTGCC

TTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTATGAGTTAAATGATGTGA

G - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTAACCACATGACGAAA

GCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 - ATGCAGAGAGAAAT

TGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCC

CATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGACTCTCGAGCC

TGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTT

CAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCAT

GTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCAGTCGTTATACAGACAAA

AGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCA

CCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAACCCGGCACCCTGGTGTAC

ATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCC

CCAAAGACAGAGAAACCAG - UNI21116 - - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAG - U

NI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAAC

CCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAGCTCCA

G - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAGTGAAGGAGA

CCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTT

ATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATG

GGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGTCCTGCGCATAGAAG

TTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAG GC

ATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCAGGA

AGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGCCCCTATCCACCAT GACTTCCAA

GAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGCCAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGG

GGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGAC

AGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCAGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCC

CTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGC

TGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGC

CTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAAAAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGG

AATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAATGTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATG

TGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTGTTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATT

ACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGTGAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGATT

CCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAACAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAG

CATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTATTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGC

CAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGCCAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTC

CTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTTTCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTA

AAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTTATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGA

TTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACAAATATAAATAAACATCAAAATACTATCTGTGACAGCACATAG

AGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGATGGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAA

GTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAACATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAG

GGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAACGAATATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGCAT

TCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGATGAATTCCTAATAAACTCATCAACCATG
Translation
MSKSSRSARSFFTNAAAKLPSSKKDDLSSKQKKTSRGDKTERIGSEGNLTEYQQVQAAATSAQRKAAAAHKE - UNI5668 - - UNI27183 - - 

UNI29474 - - UNI30503 - - UNI31842 - - UNI32282 - EQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLGGPR

SSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - UNI588 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI

27183 - - UNI30503 - TKSPKLS - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 -  - UNI2242 - - UNI300

32 -  - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556 -  - UNI21116 - - UNI27753 -  - 

UNI5224 - - UNI8240 - - UNI27753 -  - UNI8240 - - UNI10426 -  - UNI10426 -     
Transcript ENSMUST00000114627
Sequence
AAGTTTGTAACTGACCATACCATACTCCAGAGACAAAGGTGGAACTGCAGCCCAGGACCCCTGAAAGTCGCCCTCAAAGGATTATACTACTTATATGTCA

CTCTGTCCTCCACCCTGTTGTCTTCTTAG - UNI34867 - ATCCTTCTTTACAAACGCAGCTGCTAAGTTGCCGTCCTCTAAGAAGGATGATTTAAG

CAGCAAGCAGAAGAAAACCAGCCGAGGTGACAAGACAGAGAGAATTGGAAGCGAAGGAAACTTGACAGAGTATCAGCAGGTGCAGGCTGCAGCAACTTCA

GCTCAGAGGAAGGCAGCGGCGGCTCACAAAG - UNI5668 - - UNI27183 - - UNI29474 - - UNI30503 - - UNI31842 - - UN

I32282 - AACAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCTTTCTAATGGAAACGCCAGGGC

TCAGGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGTGGGCCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGAC

AGGAAGAGAGAGGCGTTCCTAGAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGACCAG - UNI5

88 - - UNI1514 - - UNI12768 - - UNI16328 - - UNI27183 - - UNI30503 - ACAAAAAGTCCCAAGCTGTCCCACAGTCCTC

AACCTCCCAATTTGGGGGATCCGGTTGAACATTTATCAGAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAG

AGGCAGTCGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGG - UNI1514 - - UNI2242 - - UNI12

768 - - UNI15271 - GTGTCCTCTACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATCCGAG

CTCTCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCATCTACATCAAGGATGACAGCAGAAATGTCTACTA

TGAGTTAAATGATGTGAG - UNI2242 - - UNI30032 - GAATATCCAAGACAGATCCCTTCTCAAAGTATACAACAAGGATCCTTCACATGCAT

TTAACCACATGACGAAAGCCGTGAACGGAGACATGAGG - UNI4124 - - UNI21116 - - UNI29789 - - UNI29852 - - UNI30556

 - ATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGGCTCACCCACCTCATGTAATTCCAAACTCCCCAC

CATCAACTCCGGTGCCCCATTCCTTACCTCCCTCTCCATCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAG

GGACAGACTCTCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCAAACCGGATGAAGACATGAGCAGC

AAAAACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTACCTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTT

TGGATGTCCCAGATCATGTCATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAATGCATATGGAGCA

GTCGTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGGCTCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTA

AGAATGATAGACCTGCACCCGCATCTTAACACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGGAAC

CCGGCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGGGCCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTA

CAGCACCACTACAATCCCCAAAGACAGAGAAACCAG - UNI21116 - AGAGAGGATGCAAGCCATGGAGAAGCAGATTGCCAGTCTAACTGGCCTTG

TTCAGTCTGCGCTTTTTAAAGGGCCCATTACAAGTAGTAGCAAAGAGGCGTCTAG - UNI27753 - TGAGAAAATGGTGAAAGCCACAGCCAACAGG

AACCAAGCAGATGGTGCAG - UNI5224 - - UNI8240 - - UNI27753 - GAACGGCCCATGTTTCTGCAGGGAAGGTTCTGGGCTCTGTGGA

GTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCATCCACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAA

CTCCAGCAGATGAGGCAGCTCCAG - UNI8240 - - UNI10426 - CTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGA

AATCAGTAACAAAGTGAAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACAGAAGTACCTCCACGAA

GAAGAGCGGATTGTCAAAAAGTTATG - UNI10426 - TGAGCTGGAGGACTTTGTTGAGGACTTGAAGAAGGACTCTTCCTCCACTGGCAGAGTGGT

GACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGCGACAAGTGGGAGAAGCTGTGGCCACTCTCAAAG GAGAATTTCCAACTTTGCAAAATAAGAT

GCGTGCTGTCCTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAGCGTGTGAGGAGCATGACAGAT

GTCTTGACGATGTTGCGGAG GCATGTCACTGATGGGCTCCTGAAAGGCACCGATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCT

GCAGAGGTCCTGAAGCATCAGGAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCAGAAGTGGTGC

CCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCCAGCACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCC

TGGAGGAACCAGACCTCACACAGCCAGCCCTCCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTG

AATGGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTGTGAGTGCCAAGAACAGGGCAGTGTCCATTGAG AAGGCAGAAAAGAAATGGGAA

GAAAAAAGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACATCATGAAGTCAATTCCAAACCTGGAGA

TGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGGGATAAGCTGGAGCTGTCAG AAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGA

TAGGGGGAAAGTCACCCCCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGGCGATGTGGTCTACAC

TGGCAGGAGCATGTCTAAG GTGAGCAGTGAAGACCCTGGGCCAACACCACAGACTAGAGCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGC

CCCATCCCCACCACCAGTCCCTGCCCCTTCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAG GCATTCCAGAA

GTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAAGACACTAGGGCAGGCGCCACAGCCCCACCCAAG

GAGAAGAAG AATTTGGAATTTTACCACGAAGATGTACGAAAATCTGATGTTGAATGTGAAAATGGCCCCCAAGTGGAATCTCAAAAG GTTACTGCAGG

GGCTCTGAGACCTAGTGGCCCCCCCAAATGGGAAAGAGTCATGGTGGATAGTATATCTGACACCTCAAGAACATCAGAATGTAGAGCTGACACCTTCACA

GAGGAAAATGCCACACCCAATAAGAGCTTATTCAGAGACAGTAGAAATTATTCCCAGAAAAATGTGCCTAAGGTCAGTTTTTCTTCCTCTGGCCTGAACT

CATTAGAAGGTGAAATCAACAAAGGGCCTAATGTCTCGGGACTACAGTGTGCTATTCCTGACTTGGAAAATCAGAAGTTAAATTTTGGAAAGACAAAAGA

GATAGGCCAACAGGGACAAGAAAATGCAGACAAGAGTCACATTCCTCTCCCAACTCGATCAGCAGAATTCAGTATTCATGATGTCAAAACACAAGATCAA

GATGTTCCCGTGACAGGTTATGGCCAAGTTGTCCTGAGATCGAAGGTGGGTAGGCACGCTAATATGAACATGAATGAGGATGGAGAATCAACTCCAAGTT

CTCCCAGTGAGGAACACACAGCCACTGATAACATCGCCTTTATGATCACCAAAACTGCTGTCCAGGTTCTGTCCAGCGGGGAGGTCCATGACATAGTGAG

TCAAAAAGGACAAGATGTACAGACAGTTAATATTGATGGAAGGAAAGAGACAGCCTCTCAGCACGAAGGGACAGAAGGGGAAGAACCGGTTGTGTGCCTG

GACAAGAAACCAGTTATTATCATTTTTGATGAACCCATGGACATCCGATCTGCATATAAAAGACTCTCAACCATCTTTGAGGAATGCGATGAGGAGCTAG

AGAGAATGCTGACAGAGGAAAAGATAGAGGAAGAGGAAGAGGATGAAAACGAAGACTCTGGAGTCCGAACCTCATCCCAAATGTCCTGTGAACAGGTCGA

CTCGAGAAGTGATAGGATGGGACAAAAGGCAGAGACACAGTCACAGCCCCATGTCCTGTCAGCAGAGTTGCTAACTCCAGGAGTGCAGGGGGTTCGTAAA

GCCGAGCAGAGAAAGCTTAGCTCAGCTGATTCTCCAGACTCAGGGAATAAGTGTGGCATGGTTGATGACCAGTTTGAAAGTCCCAAGAAAAAGTTTAAGT

TCAAATTCCCTAAAAAGCAGCTTGCTGCTCTTACACAGGCAATTCGCACAGGCACCAAAACGGGAAAGAAAACCCTGCAGGTGGTTGTCTATGAGGAAGA

GGAAGAGGACGGTACTTTGAAACAGCACAAAGAAGCCAAGCGGTTTGAAATCACCAGGTCACAGCCTGAAGATGCCCTCAAAACCATGGCTAGGAGGCAA

GAGCAGCTCAGCCCTGAGGGCACCCTTCCGGCATCAAGGACTGATGAAATTAGGAAAAGTACTTACAGAACACTGGACAGCCTGGAGCAGACCATAAAGC

AACTTGAAAATACAATCAGTGAAATGAGCCCCAGGGCCCTAGTTGATACCTCATGTTCTTCCAACAGAGATTGTGGTGCAAGCTTGCCCCACATGGCCCA

AGAGGTCTCTCCCCGGTCCTTGCTAGTTCTGGATGAAGTACCCCCTGCCCCAGAGCCCCCCACATCCATATCTCCAGCTTCACGTAAG GGCTCCAGCAC

CACCCCACAGACAAGCCGGATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACTACAGGATCCCCGC

CAATACCGTCAG GCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACTTCCCCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCC

AGCTCTGGGAAAAGCAGTTCTCTGCCTTCCGCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCTCA

GCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAGTTTCAGAGCCCACCTCACGCAGGTAAAGGCCA

TCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCCGAGCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTG

AATCAAGGTGCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGCAAAGCCACCCCATCCACAGCAA

AAGAAACGTCTTAAAGGCCAGATCCTATTAGGCACAAGGTGGAATTGCATCCTTGTTTTTAATTTTCAGCAATCTGGAACAAGTGTTTTCATAAGAGAAT

GTATCATATTGCTGTATCGTTCAAGGCTTCATGCAGAGTATGTGCTAAGTACTGAGTTGGTAGCTGCAGTAAAGCTTGTTTTTTTTCCACTCTGTTGCTG

TTGTAATTGCATAGTGTTTACTGTCTAGATTCGATACCTATTACATGAAGAAAGCATGTGCTATAAAAAGAGAGAGTATGATGAGAGTGAAGACATGTGT

GAGACAAGCTGACTGTACTATGCATGTAAAACATGTATGATTCCAGAATTTTAGTATGTTTTGTATAAAAATATTTTTCATTACAGAGACTAGAGGCAAA

CAGAGAAATAAATACGCAAGCGTGACTATATAAATTGTAAAGCATATATTATGATATTTTCTTTTATTTTAGTGTTATTTAGCTTTATTACAGATTTCTA

TTTTTGTCAAAACTTCATGGTTCCTTTCAAAATCTTTTTTGCCAAAACATTTTGATACTACAGCATTGTACATTTGAAAGTAGCGTGCTAGCCTTTAAGC

CAATGAGCTTCTACAGTCGTAGAAAGAAATTCAGCAAAACTCCTGCACTGCCAGCAAAAGTTTGTATGATAATTCGCTAGCGCAAGCCAGCTCATTTTTT

TCTTTGTTTTCTTTTCATTTTCTTCTTCCTTTTTTTTTTTTAAAGACAAAACATCTGAGTATTCTGTAGCTGTTTTCTTTGCACTGTCTGACCCCCTTTT

ATGTTTTCTTAGACCTGGTAATTCATACCATTGCATTGTGGATTTTAAAATGTACACTTCTGTATGGTTCTGTACACTGAGGAACTTTTGTAAATATACA

AATATAAATAAACATCAAAATACTATCTGTGACAGCACATAGAGTAGTTTTCCCACACCAAAGTTAATTTGTATGCATGCTTAAGAGTCTATATTGGGAT

GGGCAGAAATGGGACTATCCATACATTTTTAAAAAGCAACAAGTTTGCACAGTTAGGGTGGTTTTGTAGATAACTGTATTTGTATAACACAGCCATGTAA

CATATGGAGCTATAAGCAGAGACTTGGCAAAACTAAATAAAGGGCTGCATGCTTATTATTTTTTTTTTGTACCTTGTCACTATAACGTCTTTCAGTCAAC

GAATATGTAACTATTGCCACAGGGTTTCAGCTCTGAGGGCATTCTAAGCAACGTGTAATCACATCCACTCATACAGTGTTGCTTCCTCGAAAGGGAAGGA

TGAATTCCTAATAAACTCATCAACCATGTGGCCGTCTGG
Translation
MSLCPPPCCLLR - UNI34867 - RSFFTNAAAKLPSSKKDDLSSKQKKTSRGDKTERIGSEGNLTEYQQVQAAATSAQRKAAAAHKE - UNI5668

 - - UNI27183 - - UNI29474 - - UNI30503 - - UNI31842 - - UNI32282 - EQGRSNLHVTSQEDAACRRPRERLSNGNARAQ

VSKPARNIPRRHTLGGPRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ - UNI588 - - UNI1514 - - UNI12768 - 

- UNI16328 - - UNI27183 - - UNI30503 - TKSPKLSHSPQPPNLGDPVEHLSETSGDSLEAMSEGEVPSPFARGSRTRASLPVVRSANQT

KERSLG - UNI1514 - - UNI2242 - - UNI12768 - - UNI15271 - GVLYLQYGDETKQLRMPNEVTSTDTIRALFVSAFPQQLTMKML

ESPSVAIYIKDDSRNVYYELNDVR - UNI2242 - - UNI30032 - RNIQDRSLLKVYNKDPSHAFNHMTKAVNGDMR - UNI4124 - - UNI

21116 - - UNI29789 - - UNI29852 - - UNI30556 - MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGS

RPMAIPGNATIPRDRLSSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDHVIAYHRTAIRSASAY

CSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHLNTHGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVD

LGPPLVEKQGFAYSTTTIPKDRETR - UNI21116 - RERMQAMEKQIASLTGLVQSALFKGPITSSSKEASS - UNI27753 - SEKMVKATANR

NQADGAG - UNI5224 - - UNI8240 - - UNI27753 - GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQL

Q - UNI8240 - - UNI10426 - LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLC - UNI10426 - 

CELEDFVEDLKKDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLKG GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRR RHV

TDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKSEVVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTAS

PPAITQEVTSAQSAPGPQSPQTPVNGSSMQSLFIEEIHSVSAKNRAVSIE KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVS

KGDAAGDKLELSE EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSK VSSEDPGPTPQTRATKCPPEEPASAWAPSPPPV

PAPSSKEEEEEEEEGDKIMAELQ AFQKCSFMDVNPNSHAEQSRANSHLKDTRAGATAPPKEKK NLEFYHEDVRKSDVECENGPQVESQK VTAGALRP

SGPPKWERVMVDSISDTSRTSECRADTFTEENATPNKSLFRDSRNYSQKNVPKVSFSSSGLNSLEGEINKGPNVSGLQCAIPDLENQKLNFGKTKEIGQQ

GQENADKSHIPLPTRSAEFSIHDVKTQDQDVPVTGYGQVVLRSKVGRHANMNMNEDGESTPSSPSEEHTATDNIAFMITKTAVQVLSSGEVHDIVSQKGQ

DVQTVNIDGRKETASQHEGTEGEEPVVCLDKKPVIIIFDEPMDIRSAYKRLSTIFEECDEELERMLTEEKIEEEEEDENEDSGVRTSSQMSCEQVDSRSD

RMGQKAETQSQPHVLSAELLTPGVQGVRKAEQRKLSSADSPDSGNKCGMVDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVVYEEEEEDG

TLKQHKEAKRFEITRSQPEDALKTMARRQEQLSPEGTLPASRTDEIRKSTYRTLDSLEQTIKQLENTISEMSPRALVDTSCSSNRDCGASLPHMAQEVSP

RSLLVLDEVPPAPEPPTSISPASRK GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQ ANGSAKKAGGDCKPTSPSLPASKIPALSPSSG

KSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLKFQSPPHAGKGHHHLSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQG

ARGIRTIHTPSLASYKAQNGSSSKATPSTAKETS

For any suggestions or comments, please send an email to unitrap@crg.es