Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036646 (Man1b1)
Chromosomal location
Chr 2: 25187935 - 25207732 (+)
Description
mannosidase, alpha, class 1B, member 1 Gene [Source:MGI (curated);Acc:Man1b1-001]
RefSeq_dna
NM_001029983 
RefSeq_peptide
NP_001025154.1 
UniGene
Mm.270798 
MGI
MGI:2684954 
Uniprot/SPTREMBL
A2AJ15 Q8BTW7 Q8R3F8 Q923C1 A2AJ14 
Human Ortholog
ENSG00000177239 (MAN1B1)
Omim not available
UniTrap UNI35109
Vector Insertion
Chr 2: 25188103 - 25188275
Public Clones IST14807F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27398
Vector Insertion
Chr 2: 25189064 - 25189896
Public Clones not available
Private Clones OST60651 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24941
Vector Insertion
Chr 2: 25190013 - 25193632
Public Clones not available
Private Clones OST200416 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32145
Vector Insertion
Chr 2: 25197237 - 25198743
Public Clones IST11910F3 (tigm) IST12150G3 (tigm) IST12525A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042390
Sequence
GGGCGGGGTGTGGATGCCTTCGTTATGGCAGCCCGCGGTCTTTCTCAGTCTTGGGCTTCCTGACGCCTCCAGCAAGCGAGGTCTTTTGGGCCGGCTTCGC

AGTTATGTACCCACCGCCGGCGCCGCCGCCGGCGCCTCACCGGGACTTCATCTCGGTGACGCTGAGCCTGGGCGAGAGCTACGACAACAGCAAGAGCCGG

CGGCGGCGCTCATGCTGGAGG AAATGGAAGCAGCTTTCGAGGCTACAGCGGAATGTGATTCTCTTCGTCTTGGGCTTTCTGATTCTCTGTGGATTCCTG

TACTCTCTTCATACGGCTGACCAGTGGAAAG - UNI27398 - CTCTGAGTGGCAGACCTGCAGAAGTAGAGAAGATGAAGCAAGAAGTCCTGCCTGT

CTTACCAGCGCCTCAGAAGGAAAGTGCTGAACAAGAAGGGTTTGCAGACATACTCTCTCAG - UNI24941 - AAGCGGCAAAGGCATTTTCGGCGGG

GCCCTCCCCATCTGCAGATTAGACCCCCCAACACAGTCTCCAAGGATGGGATGCAGGATGATGCTAAGGAGAGAGAAGCAGCCCTGGGGAAGGCTCAGCA

GGAAGAAAACACACAGAGAACCGTCATCAG CTGGCGGGGAGCCGTGATTGAGCCTGAACAGGCCACTGAACTTCCTTACAAAAGAGCTGAAGCCTCCAT

CAAACCTCTGGTTTTGGCATCCAAGATATGGAAAGAGCCAG - UNI32143 - CCCCCCCGAATGAGCGCCAGAAGGGAGTGATTGAGGCCTTTCTCC

ATGCTTGGAAGGGTTACCAAAAGTTTGCTTGGGGCCATGATGAACTAAAACCTGTGTCCAAAACCTTCAGTGAGTGGTTTGGCCTGGGCCTCACCCTGAT

CGATGCCTTGGATACCATGTGGATTTTGGGTCTGAAGCAAG AATTTAAGCAAGCCAGGAAATGGGTATCAGAGAACTTAGACTTTCAGAAGAATGTTGA

TGTCAACCTGTTTGAGAGCACCATTCGCATCTTAGGGGGCCTGCTGAGTACCTACCACCTGTCGGGGGACAGCCTCTTCCTGACCAAAGCT GAAGATTT

TGGAAAACGGCTGATGCCTGCCTTCACTACGCCCTCCAAGATCCCATACTCTGATGTGAACATTGGCACTGGATTTGCCCACTCACCCCAGTGGACTTCA

GACAGCACGGTGGCAGAAGTGACGAGCATTCAGTTGGAGTTCCGGGAGCTCTCTCGTCTTACTGGAATAAAGAAATTCCAG GAGGCCGTGGAGGAAGTG

ACAAAGCACATCCACTCCCTGTCTGGGAAGAAAGACGGGCTGGTGCCTATGTTCATCAACACGAACAGCGGCCTCTTCACCCACCCAGGAGTGTTCACCT

TGGGGGCCAGGGCTGACAGCTACTACGAATACCTGCTGAAACAGTGGATCCAGGGTGGCAAGAAGGAGACACA GTTGCTGGAAGACTATGTTAAAGCCA

TTGAGGGGATAAAAGCCCATCTGCTCCGGCAGTCTCAGCCCAGAAAGCTCACCTTCGTGGGAGAACTTGCCCACGGCCGCTTCAGTGCCAAGATG GACC

ACTTAGTGTGCTTCCTGCCGGGGACGCTGGCTTTGGGTGTCCACCATGGCCTGCCAGCTGACCACATGGATCTAGCTCGGGCCCTCATGGAGACCTGCTA

CCAGATGAACCAACAGATGGAGACAGGTCTGAGCCCTGAGATTGCACATTTCAACATGTACCCTCGGGCAGATCATAAAGATGTGGAGGTCAAG CCAGC

TGACAGGCACAACCTGCTGCGGCCAGAGACGGTGGAAAGCCTATTCTATCTGTACCGTGTCACAAGGGACCGCAAGTACCAGGACTGGGGCTGGGAAATC

CTGCAGAGCTTCAATAAGTACACACGG GTCCCCTCAGGTGGCTATTCTTCTATCAACAACGTCCAGAATTCCCACAAGCCTGAGCCCAGGGACAAGATG

GAGAGCTTCTTTGTGGGGGAAACCCTGAAGTACTTGTACCTGCTCTTTTCTGATGACCTGGAGCTGCTCAGTCTGGACAGCTGTGTGTTCAACACAGAAG

CCCATCCCCTCCCCATCTGGGCTCCTGCGTAGGAGGAGAGCACCTGGTCTGGGCACTGATGGAGACTGAGGTGGGCCTGTTGGGTCCCTGACCTTCACAA

GGCCCACATAGTTTTGGGCAGCTGTCAAGTGTGATGTACCTGCCCAGTTGTAGGTCCCTCCAGTTTCAACTTTTCATGAAGGTGGTGGGAGGGGCAGGAG

TCAGACTAGCAGGTATGGGTTCTGGGGTTTAGGCTGGAAAGTCTACCAAGCCTTTGACTTCCTCGAAACCTCATATCATGGCTCCTGATTCCCATACCTG

AATGACCCTGTTGGCTGGCTACCGGCAGCCCCATGGTAGTCCCAAGACTTCTTATCACCTCCTGGGACCACCCAGGACCCCAGTGCCTGTATTGAGTTCA

GAGTGATAGCCCAAACCAGTGAGGTGCTGGGCATGGCCCAATGGCCTGTGATAGCCCTGACTCCTGATTGACCCATGGGTCCACTGGGCCAGTGTGACCT

TGAGGGTCTTTGTGGCTCTAGTGTTTACGGGTTGGACTCAGGGATCCTCCTGGCTACCCTACTGGGCTGGCGGGGGTTAGAACAGTAAATTTGTCTTATT

CCCAGGATACCCTGGTATAATGTGATCTCTCAGCTGAGAAGAAAGTGGACTTGGTCCCACTGTAATGGTTCTTGTGGAGAGGAGGGAAGGGGTGGTGTCT

ATCTAGACTGACCTTAAGGGGACAGCAGGTTCTCTGGATAACATCTCAGCAACTACCCTCTAAAGTCAGAGCTCCTGTCCACTTCAGGTAGGAAGGCTTT

GGGGCCATTATACAAACAGGCTAGGATGCTTGGTTGTGCCGTCTCACAAGGGCCTGTGAAGATCACATGCTGCTGCCGGCTGATAGGTTTGTGGTAGTTG

TGCCTTGGTGTCTGAGCCCATGGAGTAGGCCCTGTCTTTGATGAGTTGTTACTAGACTATCCCTGGGCCTTGGCTAGGATTCTCCTATCCAATTCCATGC

AGTACAGCATAGGGCAAACTGGACAGAATAGAAAGGACCTCAAGGCTCTGGGCCTGTGTTCCCTGTATATCCCAAGATCTGGAGATTTGACATGCTAACT

AACTCATCTGCAGCTCAGTGGCAGCCACCTTGTGCCTCTGAGGTATAGTAGCTACGCTGGGGACTTCCTGTTAAACACGTGGACCCCAAGCCAGTTCTAA

CACCAAAGGTGTTTACAAAGAAGGACTTGGCTGGTCACATATCCTTAGGCCTTGAGTTTATGGGTAGAAGCTGCCGCCCTCCACCCCCCCCCCCCCCCAT

CAGTTATAACCCTTTGGTTGATGTTAGCTTCTCCCTATGCTGTCCTCCTCTACCGGAGCCCCATAGGCTTGTGAATGGACAGGTTCAGGCGGCGCCCAGG

GCCTAAGCATTGAGAAGTGTATTCTCCATCTCCTGCCAAACTATGGCTGGTGTCAAGGGATGACAGTAACTGCCCTGTGGCCCTCTGAAGAGGTACTGTG

GATCAGAGAAACTGGGTAGATGTCCACAAAGCTGGGAGCCTCATTAAAGCATACAAGATGGGAATGGGCCTGGAAGGGGAGGCTGGTGCCCAGTAGAGGC

AGGTTTCCCTCCTCCTCCAAAGCAGGAAACCTGAGAGCTAGAGTCCCTGCTTAATTAAATGTCTAAATGGTCTCAGCAA
Translation
MYPPPAPPPAPHRDFISVTLSLGESYDNSKSRRRRSCWR KWKQLSRLQRNVILFVLGFLILCGFLYSLHTADQWKA - UNI27398 - ALSGRPAEV

EKMKQEVLPVLPAPQKESAEQEGFADILSQ - UNI24941 - KRQRHFRRGPPHLQIRPPNTVSKDGMQDDAKEREAALGKAQQEENTQRTVIS SWR

GAVIEPEQATELPYKRAEASIKPLVLASKIWKEPA - UNI32143 - APPNERQKGVIEAFLHAWKGYQKFAWGHDELKPVSKTFSEWFGLGLTLIDA

LDTMWILGLKQE EFKQARKWVSENLDFQKNVDVNLFESTIRILGGLLSTYHLSGDSLFLTKA EDFGKRLMPAFTTPSKIPYSDVNIGTGFAHSPQWTS

DSTVAEVTSIQLEFRELSRLTGIKKFQ EAVEEVTKHIHSLSGKKDGLVPMFINTNSGLFTHPGVFTLGARADSYYEYLLKQWIQGGKKETQ QLLEDYV

KAIEGIKAHLLRQSQPRKLTFVGELAHGRFSAKM DHLVCFLPGTLALGVHHGLPADHMDLARALMETCYQMNQQMETGLSPEIAHFNMYPRADHKDVEV

K PADRHNLLRPETVESLFYLYRVTRDRKYQDWGWEILQSFNKYTR VPSGGYSSINNVQNSHKPEPRDKMESFFVGETLKYLYLLFSDDLELLSLDSCV

FNTEAHPLPIWAPA
Transcript ENSMUST00000114304
Sequence
ATGCCCGCTCCCCGAGATCGAGCGCAGGACTCCGGCAAGGGTGATAGTCCACAACTCAAGCCAGACGTAACTGCAACAAAGAACACTTCTCCAAACCGTA

GTCAGTCCGCCCCCAACAGGGAGTCTGCAGGACGCCTGCAATGGAGCGGATGCGCGCGATTCAGCGAC - UNI35109 - AAATGGAAGCAGCTTTCG

AGGCTACAGCGGAATGTGATTCTCTTCGTCTTGGGCTTTCTGATTCTCTGTGGATTCCTGTACTCTCTTCATACGGCTGACCAGTGGAAAG - UNI273

98 - CTCTGAGTGGCAGACCTGCAGAAGTAGAGAAGATGAAGCAAGAAGTCCTGCCTGTCTTACCAGCGCCTCAGAAGGAAAGTGCTGAACAAGAAGGG

TTTGCAGACATACTCTCTCAG - UNI24941 - AAGCGGCAAAGGCATTTTCGGCGGGGCCCTCCCCATCTGCAGATTAGACCCCCCAACACAGTCTC

CAAGGATGGGATGCAGGATGATGCTAAGGAGAGAGAAGCAGCCCTGGGGAAGGCTCAGCAGGAAGAAAACACACAGAGAACCGTCATCAG CTGGCGGGG

AGCCGTGATTGAGCCTGAACAGGCCACTGAACTTCCTTACAAAAGAGCTGAAGCCTCCATCAAACCTCTGGTTTTGGCATCCAAGATATGGAAAGAGCCA

G - UNI32143 - CCCCCCCGAATGAGCGCCAGAAGGGAGTGATTGAGGCCTTTCTCCATGCTTGGAAGGGTTACCAAAAGTTTGCTTGGGGCCATGA

TGAACTAAAACCTGTGTCCAAAACCTTCAGTGAGTGGTTTGGCCTGGGCCTCACCCTGATCGATGCCTTGGATACCATGTGGATTTTGGGTCTGAAGCAA

G AATTTAAGCAAGCCAGGAAATGGGTATCAGAGAACTTAGACTTTCAGAAGAATGTTGATGTCAACCTGTTTGAGAGCACCATTCGCATCTTAGGGGGC

CTGCTGAGTACCTACCACCTGTCGGGGGACAGCCTCTTCCTGACCAAAGCT GAAGATTTTGGAAAACGGCTGATGCCTGCCTTCACTACGCCCTCCAAG

ATCCCATACTCTGATGTGAACATTGGCACTGGATTTGCCCACTCACCCCAGTGGACTTCAGACAGCACGGTGGCAGAAGTGACGAGCATTCAGTTGGAGT

TCCGGGAGCTCTCTCGTCTTACTGGAATAAAGAAATTCCAG GAGGCCGTGGAGGAAGTGACAAAGCACATCCACTCCCTGTCTGGGAAGAAAGACGGGC

TGGTGCCTATGTTCATCAACACGAACAGCGGCCTCTTCACCCACCCAGGAGTGTTCACCTTGGGGGCCAGGGCTGACAGCTACTACGAATACCTGCTGAA

ACAGTGGATCCAGGGTGGCAAGAAGGAGACACA GTTGCTGGAAGACTATGTTAAAGCCATTGAGGGGATAAAAGCCCATCTGCTCCGGCAGTCTCAGCC

CAGAAAGCTCACCTTCGTGGGAGAACTTGCCCACGGCCGCTTCAGTGCCAAGATG GACCACTTAGTGTGCTTCCTGCCGGGGACGCTGGCTTTGGGTGT

CCACCATGGCCTGCCAGCTGACCACATGGATCTAGCTCGGGCCCTCATGGAGACCTGCTACCAGATGAACCAACAGATGGAGACAGGTCTGAGCCCTGAG

ATTGCACATTTCAACATGTACCCTCGGGCAGATCATAAAGATGTGGAGGTCAAG CCAGCTGACAGGCACAACCTGCTGCGGCCAGAGACGGTGGAAAGC

CTATTCTATCTGTACCGTGTCACAAGGGACCGCAAGTACCAGGACTGGGGCTGGGAAATCCTGCAGAGCTTCAATAAGTACACACGG GTCCCCTCAGGT

GGCTATTCTTCTATCAACAACGTCCAGAATTCCCACAAGCCTGAGCCCAGGGACAAGATGGAGAGCTTCTTTGTGGGGGAAACCCTGAAGTACTTGTACC

TGCTCTTTTCTGATGACCTGGAGCTGCTCAGTCTGGACAGCTGTGTGTTCAACACAGAAGCCCATCCCCTCCCCATCTGGGCTCCTGCGTAGGAGGAGAG

CACCTGGTCTGGGCACTGATGGAGACTGAGGTGGGCCTGTTGGGTCCCTGACCTTCACAAGGCCCACATAGTTTTGGGCAGCTGTCAAGTGTGATGTACC

TGCCCAGTTGTAGGTCCCTCCAGTTTCAACTTTTCATGAAGGTGGTGGGAGGGGCAGGAGTCAGACTAGCAGGTATGGGTTCTGGGGTTTAGGCTGGAAA

GTCTACCAAGCCTTTGACTTCCTCGAAACCTCATATCATGGCTCCTGATTCCCATACCTGAATGACCCTGTTGGCTGGCTACCGGCAGCCCCATGGTAGT

CCCAAGACTTCTTATCACCTCCTGGGACCACCCAGGACCCCAGTGCCTGTATTGAGTTCAGAGTGATAGCCCAAACCAGTGAGGTGCTGGGCATGGCCCA

ATGGCCTGTGATAGCCCTGACTCCTGATTGACCCATGGGTCCACTGGGCCAGTGTGACCTTGAGGGTCTTTGTGGCTCTAGTGTTTACGGGTTGGACTCA

GGGATCCTCCTGGCTACCCTACTGGGCTGGCGGGGGTTAGAACAGTAAATTTGTCTTATTCCCAGGATACCCTGGTATAATGTGATCTCTCAGCTGAGAA

GAAAGTGGACTTGGTCCCACTGTAATGGTTCTTGTGGAGAGGAGGGAAGGGGTGGTGTCTATCTAGACTGACCTTAAGGGGACAGCAGGTTCTCTGGATA

ACATCTCAGCAACTACCCTCTAAAGTCAGAGCTCCTGTCCACTTCAGGTAGGAAGGCTTTGGGGCCATTATACAAACAGGCTAGGATGCTTGGTTGTGCC

GTCTCACAAGGGCCTGTGAAGATCACATGCTGCTGCCGGCTGATAGGTTTGTGGTAGTTGTGCCTTGGTGTCTGAGCCCATGGAGTAGGCCCTGTCTTTG

ATGAGTTGTTACTAGACTATCCCTGGGCCTTGGCTAGGATTCTCCTATCCAATTCCATGCAGTACAGCATAGGGCAAACTGGACAGAATAGAAAGGACCT

CAAGGCTCTGGGCCTGTGTTCCCTGTATATCCCAAGATCTGGAGATTTGACATGCTAACTAACTCATCTGCAGCTCAGTGGCAGCCACCTTGTGCCTCTG

AGGTATAGTAGCTACGCTGGGGACTTCCTGTTAAACACGTGGACCCCAAGCCAGTTCTAACACCAAAGGTGTTTACAAAGAAGGACTTGGCTGGTCACAT

ATCCTTAGGCCTTGAGTTTATGGGTAGAAGCTGCCGCCCTCCACCCCCCCCCCCCCCCATCAGTTATAACCCTTTGGTTGATGTTAGCTTCTCCCTATGC

TGTCCTCCTCTACCGGAGCCCCATAGGCTTGTGAATGGACAGGTTCAGGCGGCGCCCAGGGCCTAAGCATTGAGAAGTGTATTCTCCATCTCCTGCCAAA

CTATGGCTGGTGTCAAGGGATGACAGTAACTGCCCTGTGGCCCTCTGAAGAGGTACTGTGGATCAGAGAAACTGGGTAGATGTCCACAAAGCTGGGAGCC

TCATTAAAGCATACAAGATGGGAATGGGCCTGGAAGGGGAGGCTGGTGCCCAGTAGAGGCAGGTTTCCCTCCTCCTCCAAAGCAGGAAACCTGAGAGCTA

GAGTCCCTGCTTAATTAAATGTCTAAATGGTCTCAGCAA
Translation
MPAPRDRAQDSGKGDSPQLKPDVTATKNTSPNRSQSAPNRESAGRLQWSGCARFSD - UNI35109 - KWKQLSRLQRNVILFVLGFLILCGFLYSLH

TADQWKA - UNI27398 - ALSGRPAEVEKMKQEVLPVLPAPQKESAEQEGFADILSQ - UNI24941 - KRQRHFRRGPPHLQIRPPNTVSKDGM

QDDAKEREAALGKAQQEENTQRTVIS SWRGAVIEPEQATELPYKRAEASIKPLVLASKIWKEPA - UNI32143 - APPNERQKGVIEAFLHAWK  

     

For any suggestions or comments, please send an email to unitrap@crg.es