Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036733 (Rbm42)
Chromosomal location
Chr 7: 31426013 - 31435336 (-)
Description
RNA binding motif protein 42 Gene [Source:MGI Symbol;Acc:MGI:1915285]
RefSeq_peptide
NP_598454.1 
UniGene
Mm.473241 Mm.401747 
MGI
MGI:1915285 
Uniprot/SWISSPROT
Q91V81 
Human Ortholog
ENSG00000126254 (RBM42)
Omim not available
UniTrap UNI13299
Vector Insertion
Chr 7: 31434739 - 31434956
Public Clones CMHD-GT_329F12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27629
Vector Insertion
Chr 7: 31432835 - 31434602
Public Clones not available
Private Clones OST54967 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29343
Vector Insertion
Chr 7: 31426326 - 31429636
Public Clones PSTVU01.E401 (vanderbilt) PSTVU01.HE33T (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108143
Sequence
CCATACGTCATCGGCCGGCTCCCACCCTGAGACGACAGGGACTCGACCGTAGAACCCGCTGCGGCTGCTGGAAGGAGCGGTGAAGGCTATGGCATCAGCG

ATGGCCGGAGCAGGGCCGGCTCCGGGACTCCCGGTGGCGGGAGGGCCGGTGGTCCCGGGGCCTGGTGTCGGCATCCCGGGCAAGAGCGGCGAGGAACGCT

TGAAAGAAATGGAGGCGGAGATGGCCCT - UNI13299 - GTTTGAGCAAGAAGTATTGGGAGCTCCGGTGACCGGAATCCCAACTGCTGTGCCTGCG

GTGCCCACGGTAGAAGCGATGCAGGTCCCCCCAGCTCCTGTGATCCGCCCAATTATCGCCACCAACACATACCAACAG - UNI27629 - GTCCAACA

GACTCTGGAGGCCAGGGCAGCTGCTGCAGCCACAGTTGTTCCTCCCATGGTGGGAGGCCCTCCTTTTGTGGGCCCAG TTGGCTTTGGCCCTGCCGATCG

TGGTCACCTGGACAGTCCTGAGGCTCGAGAGGCCATGTTCCTGAGGCGAGCAG CTGTGGCCCCTCAGAGGGCCCCTATCCTGCGTCCTGCCTTCGTCCC

CCACGTGCTACAGAGAGCAG ATTCTGCCCTTTCCTCTGCAGCTGGTGGCCCCCGACCTATGGCCCTGAGGCCTCCACACCAGGCCCTGGTTGGACCCCC

TCTGCCTGGGCCTCCTGGACCACCCATGATGCTGCCACCAATGGCTCGGGCACCTGGACCACCCCTGGGTTCTATGGCTGCTCTGAGACCTCCCCTG GA

AGAGCCAGCAGCTCCACGAGAGCTAGGCCTAGGCCTTGGTTTGGGCCTGAAGGACAAGGAAGAGGCAGTAGTGGCCGCAGCGGCTGGGCTGGAGGAAGCT

AGCGCAGCAGTGGCAGTGGGGGCAGGAGGAGCCCCAGCTGGGCCTGCAGTCATTGGCCCCAGCCTCCCGCTGGCCCTCGCCATGCCCTTGCCTGAGCCTG

AGCCCTTGCCCCTCCCACTGGAGGTGGTACGTGGCCTGCTGCCTCCGCTGAGAATTCCTGAGCTCTTGTCTCTCCGTCCACGACCTCGGCCCCCTCGGCC

TGAGCCTCCTCCTGGCCTCATGGCCCTAGAG - UNI29343 - GTGCCAGAGCCACTGGGTGAAGACAAGAAGAAAGGCAAGCCAGAGAAACTGAAAC

GCTGCATTCGCACAGCAGCGGGGAGCAGCTGGGAGGACCCCAGCCTGCTGGAGTGGGATGCCG - UNI29343 - ATGACTTCCGGATCTTCTGCGGG

GATCTGGGCAATGAGGTGAACGATGACATCTTGGCACGAGCCTTCAGCCGCTTCCCATCCTTCCTTAAGGCTAAGGTGATCCGTGACAAGCGCACAGGCA

AAACCAAGGGCTATGGCTTTGTCAGCTTCAAAGACCCCAGTGACTATGTGCGCGCCATGCGAGAGATGAATG - UNI29343 - GGAAGTATGTGGGC

TCACGCCCCATCAAGCTTCGCAAAAGCATGTGGAAGGACCGGAACCTGGATGTGGTCCGTAAGAAGCAGAAGGAAAAGAAAAAGTTGGGCCTCAGATAGG

ATCTGTGGCTAAGCACCCGCTCCCACCCGGCTGTGCGCTAGCTCCTTTCAACAGTTGTCCACTCGCCTGTCCCAAAACCAGTTTCAATAAATTACCTTCA

TTTCC
Translation
MAGAGPAPGLPVAGGPVVPGPGVGIPGKSGEERLKEMEAEMAL - UNI13299 - LFEQEVLGAPVTGIPTAVPAVPTVEAMQVPPAPVIRPIIATNT

YQQ - UNI27629 - VQQTLEARAAAAATVVPPMVGGPPFVGPV VGFGPADRGHLDSPEAREAMFLRRAA AVAPQRAPILRPAFVPHVLQRAD DS

ALSSAAGGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPL EEPAAPRELGLGLGLGLKDKEEAVVAAAAGLEEASAAVAVGA

GGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALE - UNI29343 - VPEPLGEDKKKGKPEKL

KRCIRTAAGSSWEDPSLLEWDAD - UNI29343 - DDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMRE

MNG - UNI29343 - GKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR
Transcript ENSMUST00000108141
Sequence
CCACCCTGAGACGACAGGGACTCGACCGTAGAACCCGCTGCGGCTGCTGGAAGGAGCGGTGAAGGCTATGGCATCAGCGATGGCCGGAGCAGGGCCGGCT

CCGGGACTCCCGGTGGCGGGAGGGCCGGTGGTCCCGGGGCCTGGTGTCGGCATCCCGGGCAAGAGCGGCGAGGAACGCTTGAAAGAAATGGAGGCGGAGA

TGGCCCT - UNI13299 - GTTTGAGCAAGAAGTATTGGGAGCTCCGGTGACCGGAATCCCAACTGCTGTGCCTGCGGTGCCCACGGTAGAAGCGATG

CAGGTCCCCCCAGCTCCTGTGATCCGCCCAATTATCGCCACCAACACATACCAACAG - UNI27629 - GTCCAACAGACTCTGGAGGCCAGGGCAGC

TGCTGCAGCCACAGTTGTTCCTCCCATGGTGGGAGGCCCTCCTTTTGTGGGCCCAG TTGGCTTTGGCCCTGCCGATCGTGGTCACCTGGACAGTCCTGA

GGCTCGAGAGGCCATGTTCCTGAGGCGAGCAG CTGGTGGCCCCCGACCTATGGCCCTGAGGCCTCCACACCAGGCCCTGGTTGGACCCCCTCTGCCTGG

GCCTCCTGGACCACCCATGATGCTGCCACCAATGGCTCGGGCACCTGGACCACCCCTGGGTTCTATGGCTGCTCTGAGACCTCCCCTG GAAGAGCCAGC

AGCTCCACGAGAGCTAGGCCTAGGCCTTGGTTTGGGCCTGAAGGACAAGGAAGAGGCAGTAGTGGCCGCAGCGGCTGGGCTGGAGGAAGCTAGCGCAGCA

GTGGCAGTGGGGGCAGGAGGAGCCCCAGCTGGGCCTGCAGTCATTGGCCCCAGCCTCCCGCTGGCCCTCGCCATGCCCTTGCCTGAGCCTGAGCCCTTGC

CCCTCCCACTGGAGGTGGTACGTGGCCTGCTGCCTCCGCTGAGAATTCCTGAGCTCTTGTCTCTCCGTCCACGACCTCGGCCCCCTCGGCCTGAGCCTCC

TCCTGGCCTCATGGCCCTAGAG - UNI29343 - GTGCCAGAGCCACTGGGTGAAGACAAGAAGAAAGGCAAGCCAGAGAAACTGAAACGCTGCATTC

GCACAGCAGCGGGGAGCAGCTGGGAGGACCCCAGCCTGCTGGAGTGGGATGCCG - UNI29343 - ATGACTTCCGGATCTTCTGCGGGGATCTGGGC

AATGAGGTGAACGATGACATCTTGGCACGAGCCTTCAGCCGCTTCCCATCCTTCCTTAAGGCTAAGGTGATCCGTGACAAGCGCACAGGCAAAACCAAGG

GCTATGGCTTTGTCAGCTTCAAAGACCCCAGTGACTATGTGCGCGCCATGCGAGAGATGAATG - UNI29343 - GGAAGTATGTGGGCTCACGCCCC

ATCAAGCTTCGCAAAAGCATGTGGAAGGACCGGAACCTGGATGTGGTCCGTAAGAAGCAGAAGGAAAAGAAAAAGTTGGGCCTCAGATAGGATCTGTGGC

TAAGCACCCGCTCCCACCCGGCTGTGCGCTAGCTCCTTTCAACAGTTGTCCACTCGCCTGTCCCAAAACCAGTTTCAATAAATTACCTTCATTTCCATC
Translation
MASAMAGAGPAPGLPVAGGPVVPGPGVGIPGKSGEERLKEMEAEMAL - UNI13299 - LFEQEVLGAPVTGIPTAVPAVPTVEAMQVPPAPVIRPII

ATNTYQQ - UNI27629 - VQQTLEARAAAAATVVPPMVGGPPFVGPV VGFGPADRGHLDSPEAREAMFLRRAA AGGPRPMALRPPHQALVGPPLP

GPPGPPMMLPPMARAPGPPLGSMAALRPPL EEPAAPRELGLGLGLGLKDKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEP

LPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALE - UNI29343 - VPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDAD - U

NI29343 - DDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNG - UNI29343 - GKYVGSRPIK

LRKSMWKDRNLDVVRKKQKEKKKLGLR
Transcript ENSMUST00000042726
Sequence
TATCCGTACAGCCGCGTCTGTCAGATTAGAGGCCCTTCCGGGGCCCTGACTTTCCGACACTCTAATTGGCTTTTGCTCGCTCTGGGGGTGTGGCCAAGTC

TCAGCCCCTGTTCTTAAACTACGTCCTCACGCAGCGCATCCGTCGCGGTAGTCCATACGTCATCGGCCGGCTCCCACCCTGAGACGACAGGGACTCGACC

GTAGAACCCGCTGCGGCTGCTGGAAGGAGCGGTGAAGGCTATGGCATCAGCGATGGCCGGAGCAGGGCCGGCTCCGGGACTCCCGGTGGCGGGAGGGCCG

GTGGTCCCGGGGCCTGGTGTCGGCATCCCGGGCAAGAGCGGCGAGGAACGCTTGAAAGAAATGGAGGCGGAGATGGCCCT - UNI13299 - GTTTGA

GCAAGAAGTATTGGGAGCTCCGGTGACCGGAATCCCAACTGCTGTGCCTGCGGTGCCCACGGTAGAAGCGATGCAGGTCCCCCCAGCTCCTGTGATCCGC

CCAATTATCGCCACCAACACATACCAACAG - UNI27629 - GTCCAACAGACTCTGGAGGCCAGGGCAGCTGCTGCAGCCACAGTTGTTCCTCCCAT

GGTGGGAGGCCCTCCTTTTGTGGGCCCAG TTGGCTTTGGCCCTGCCGATCGTGGTCACCTGGACAGTCCTGAGGCTCGAGAGGCCATGTTCCTGAGGCG

AGCAG CTGTGGCCCCTCAGAGGGCCCCTATCCTGCGTCCTGCCTTCGTCCCCCACGTGCTACAGAGAGCAG ATTCTGCCCTTTCCTCTGCAGCTGGTG

GCCCCCGACCTATGGCCCTGAGGCCTCCACACCAGGCCCTGGTTGGACCCCCTCTGCCTGGGCCTCCTGGACCACCCATGATGCTGCCACCAATGGCTCG

GGCACCTGGACCACCCCTGGGTTCTATGGCTGCTCTGAGACCTCCCCTG GAAGAGCCAGCAGCTCCACGAGAGCTAGGCCTAGGCCTTGGTTTGGGCCT

GAAGGACAAGGAAGAGGCAGTAGTGGCCGCAGCGGCTGGGCTGGAGGAAGCTAGCGCAGCAGTGGCAGTGGGGGCAGGAGGAGCCCCAGCTGGGCCTGCA

GTCATTGGCCCCAGCCTCCCGCTGGCCCTCGCCATGCCCTTGCCTGAGCCTGAGCCCTTGCCCCTCCCACTGGAGGTGGTACGTGGCCTGCTGCCTCCGC

TGAGAATTCCTGAGCTCTTGTCTCTCCGTCCACGACCTCGGCCCCCTCGGCCTGAGCCTCCTCCTGGCCTCATGGCCCTAGAG - UNI29343 - GTG

CCAGAGCCACTGGGTGAAGACAAGAAGAAAGGCAAGCCAGAGAAACTGAAACGCTGCATTCGCACAGCAGCGGGGAGCAGCTGGGAGGACCCCAGCCTGC

TGGAGTGGGATGCCG - UNI29343 - ATGACTTCCGGATCTTCTGCGGGGATCTGGGCAATGAGGTGAACGATGACATCTTGGCACGAGCCTTCAGC

CGCTTCCCATCCTTCCTTAAGGCTAAGGTGATCCGTGACAAGCGCACAGGCAAAACCAAGGGCTATGGCTTTGTCAGCTTCAAAGACCCCAGTGACTATG

TGCGCGCCATGCGAGAGATGAATG - UNI29343 - GGAAGTATGTGGGCTCACGCCCCATCAAGCTTCGCAAAAGCATGTGGAAGGACCGGAACCTG

GATGTGGTCCGTAAGAAGCAGAAGGAAAAGAAAAAGTTGGGCCTCAGATAGGATCTGTGGCTAAGCACCCGCTCCCACCCGGCTGTGCGCTAGCTCCTTT

CAACAGTTGTCCACTCGCCTGTCCCAAAACCAGTTTCAATAAATTACCTTCATTTCCATCCCTGA
Translation
MASAMAGAGPAPGLPVAGGPVVPGPGVGIPGKSGEERLKEMEAEMAL - UNI13299 - LFEQEVLGAPVTGIPTAVPAVPTVEAMQVPPAPVIRPII

ATNTYQQ - UNI27629 - VQQTLEARAAAAATVVPPMVGGPPFVGPV VGFGPADRGHLDSPEAREAMFLRRAA AVAPQRAPILRPAFVPHVLQRA

D DSALSSAAGGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPL EEPAAPRELGLGLGLGLKDKEEAVVAAAAGLEEASAAV

AVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALE - UNI29343 - VPEPLGEDKKKGK

PEKLKRCIRTAAGSSWEDPSLLEWDAD - UNI29343 - DDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVR

AMREMNG - UNI29343 - GKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

For any suggestions or comments, please send an email to unitrap@crg.es