Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036745 (Ttll7)
Chromosomal location
Chr 3: 146515371 - 146645714 (+)
Description
tubulin tyrosine ligase-like family, member 7 Gene [Source:MGI (curated);Acc:Ttll7-001]
UniGene
Mm.187793 Mm.405954 Mm.473962 
MGI
MGI:1918142 
Uniprot/SWISSPROT
A4Q9F0 
Uniprot/SPTREMBL
B2RR87 
Human Ortholog
ENSG00000137941 (TTLL7)
Omim not available
UniTrap UNI28266
Vector Insertion
Chr 3: 146556965 - 146557165
Public Clones not available
Private Clones OST35733 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106134
Sequence
ATGCCATCTCTGCCTCAAGATGGGG - UNI28266 - TTATTCAGGGATCATCTCCTGTGGATCTGGGTACAGAATTACCTTACCAATGCACAATGAA

AAGGAAAGTGAGAAAAAAGAAGAAGAAGGGAATTATTACAGCTAATGTTGCCGGAACAAAGTTTGAAATTG TTCGTTTAGTAATAGATGAGATGGGATT

TATGAAAACTCCTGATGAAGATGAGACAAGCAATCTTATCTGGTGTGATGCTGCTGTTCAGCAGGAGAAGATTACAGACCTGCAGAACTACCAG AGAAT

CAACCATTTTCCAGGAATGGGAGAGATCTGTAGGAAGGATTTCTTAGCAAGAAATATGACGAA AATGATCAAGTCTCGGCCTATGGATTATACCTTTGT

TCCGAGAACGTGGATTTTCCCTTCTGAATATACTCAGTTCCAAAACTATGTGAAAGAATTGAAGAAAAAACGGAAGCAGAAAACTTTTATAGTAAAACCA

GCTAATGGTGCAATGGGTCATGG GATTTCATTGATAAGAAATGGGGATAAAGTCCCTTCTCAGGATCATTTGATAGTTCAAGAATACATTGAGAAACCT

TTCCTAATGGAAGGCTACAAGTTTGACTTACGGATTTATATTTTGGTTACATCCTGTGATCCATTAAAGATATTTCTCTACCATGATGGGCTTGTGCGCA

TGGGCACTGAGAAGTACATCCCACCAAACGAGTCCAACTTG ACCCAGTTATACATGCATCTGACCAACTACTCAGTGAACAAACACAATGAACGGTTTG

AGCGCAATGAAACTGAAGACAAAGGCAGCAAGCGGTCAATCAAGTGGTTTACGGAATTCCTACAGGCCAATCAACATGATGTCACTAAGTTCTGGAGTGA

TATTTCA GAGTTGGTGGTAAAGACTCTGATTGTGGCAGAACCTCACGTCCTGCACGCCTACCGGATGTGCAGACCCGGTCAGCCCCCCGGGAGCGAAAG

TGTCTGCTTCGAAGTCCTGGGGTTCGACATCTTGTTGGATAGAAAGCTCAAGCCATGGCTTCTGGAG ATTAATCGAGCCCCAAGCTTTGGAACTGATCA

GAAAATCGATTATGATGTTAAAAGGGGGGTTCTGCTAAACGCGCTGAAGCTGCTGAACATCAG GACCAGCGATAAAAGGAAAAACTTGGCCAAGCAAAA

AGCGGAGGCTCAGAGGAGGCTGTACGGTCAAAACCCAGTAAGAAGGCTTTCGCCAGGCTCCTCCGACTGGGAACAGCAGAGGCACCAGCTGGAGAGGCGG

AAAGAAGAGTTG AAAGAGAGACTCCTTCAAGTACGAAAGCAGGTTTCGCAGGAAGAACATGAAAACCGACATATGGGGAATTACAG GAGAATTTATCC

TCCTGAAGACAAAGCACTGCTTGAGAAGTATGAAGGTTTGCTGGCCGTCGCCTTCCAGACCTTCCTCTCGGGAAGAGCAGCTTCATTCCAGCGAGAAATG

AACAATCCTCTGAAAAAGATGCGG GAGGAAGATCTCCTGGATCTTCTGGAGCAGTGCGAAATCGATGATGAAAAGCTGATGGGGAAAACCGGCCGGGTC

CGAGGACCGAAG CCCCTGTGCTGCATGCCAGAGTGTGCAGAGGTCACGAAGAAGCAGAAGTATTACGGTAGCAGTGACAGCAGCTACGACAGCAGCAGC

AGCAGCAGCAATTCAGAGCTGGATGAGAACGAAAAAGAGCTGTGTCAGAAGAGACTAGACCAAGTCCCATATAGCCTTAAGCACACCAGTCACTGCAAGA

TAATCCAGCAATCCA ATTCCATGAGGCGTTCGGTCAGCTGCCCTCGGTCCATCTCTGCTCACTTACCTTCCAGAGGGGATGTGCGCCCCTTTTCTTCTC

AACAAGTGATACCATTAGCAAGACCAACGTCAGCGTCCCGGTCACATTCCTTAAACCGCGCTTCATCCTACGCGAGACACCTGCCTCACGGCAGTGACAC

CGGCTCTACCAACACTCTG AACGAGTCTTTGCGGCAATTGAAAACCAAAGAGCAGGAAGACGACCTCACCAGTCAGACCTTGTTTGTCCTCAAGGACAT

GAGAATCCGCTTTCCGGGGAAGTCAGACGCAGAGTCGGAGCTCCTGATAGAAGAT ATCATGGATAACTGGAAGCATTATAAAACAAAAGTGGCTTCATA

TTGGCTCATAAAATTGGACTCTGTAAAACAACGGAAA GTTTTGGACATAGTAAAATCAAGTATTCGTACAGTTCTTCCAAGAATCTGGAGGGTCCCTGA

TGCTGAAGAACTGAGTTTATACCGGATTTTCAACAGGGTATTTAATCGCCTACTCTGGAGTCATGGCCAAGGACTGTGGAGCTGTTTCTGTGATTCAGG 

ATCCTCTTGGGAGAGCATCTTCAGTAAGAGCCCTGAGGTGGTGACCCCTCTGCAGCTCCAGTGCTGCCAGCGCCTGGTGGAGCTTTGCAAGCAGTGCCTG

CTGGTGGTTTACAAATACACAACAGAAACAAGAGGACCCATCTCAGGCATCGGTCCTGACTGGGGGAACTCCAG GTATTTGCTACCAGGAAGTACCCAA

TTTCTTATGAGATCACCACTGTACAACATGAAATATAATTCACCCGGAATGACTCGCTCCAATGTTTTGTTTACGTCCCGCTATGGCCGTTTGTGA
Translation
MPSLPQDGV - UNI28266 - VIQGSSPVDLGTELPYQCTMKRKVRKKKKKGIITANVAGTKFEIV VRLVIDEMGFMKTPDEDETSNLIWCDAAVQQ

EKITDLQNYQ RINHFPGMGEICRKDFLARNMTK KMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHG GISLIRNGDK

VPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNL TQLYMHLTNYSVNKHNERFERNETEDKGSKRSIKWF

TEFLQANQHDVTKFWSDIS ELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLE INRAPSFGTDQKIDYDVKRGVLLNAL

KLLNIR RTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPGSSDWEQQRHQLERRKEEL KERLLQVRKQVSQEEHENRHMGNYR RRIYPPEDKALLEKYE

GLLAVAFQTFLSGRAASFQREMNNPLKKMR EEDLLDLLEQCEIDDEKLMGKTGRVRGPK PLCCMPECAEVTKKQKYYGSSDSSYDSSSSSSNSELDEN

EKELCQKRLDQVPYSLKHTSHCKIIQQSN NSMRRSVSCPRSISAHLPSRGDVRPFSSQQVIPLARPTSASRSHSLNRASSYARHLPHGSDTGSTNTL N

ESLRQLKTKEQEDDLTSQTLFVLKDMRIRFPGKSDAESELLIED IMDNWKHYKTKVASYWLIKLDSVKQRK VLDIVKSSIRTVLPRIWRVPDAEELSL

YRIFNRVFNRLLWSHGQGLWSCFCDSG GSSWESIFSKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYTTETRGPISGIGPDWGNSR RYLLPGSTQFLM

RSPLYNMKYNSPGMTRSNVLFTSRYGRL
Transcript ENSMUST00000038090
Sequence
GCTGCTCCTGGTCCGGTCGAGCTTCTAAGCTCTGAACCGCGGCTGCCCCGGGGGGGTGGGCGAGCTGAGGTGATCCCAAGACGACACGCGGAGTGGACCG

ACCGGGGAGCCGCCAGCCGCTGGCGGGGAGTGTGGGCCACCAAGAGACCGGCCACTGGATCCAGCCAGAGAGGTGCCTCAGCT - UNI28266 - GTA

GCATCCCAGCCCAAAACTTGTGTCGTGAAATCCAAGACTTTGACCCAGATAATGTGATAGGATCTTCCTGTGACTTGGGGCCATATTCTACTTAGATGAA

CTCGGAACTTCCAGCTTTCCCGAGCGCTTGGCACTACAGGCAGGCTTCTTGCTTGCTTGGTATACGTTACCATGCCATCTCTGCCTCAAGATGGGG - U

NI28266 - TTATTCAGGGATCATCTCCTGTGGATCTGGGTACAGAATTACCTTACCAATGCACAATGAAAAGGAAAGTGAGAAAAAAGAAGAAGAAGG

GAATTATTACAGCTAATGTTGCCGGAACAAAGTTTGAAATTG TTCGTTTAGTAATAGATGAGATGGGATTTATGAAAACTCCTGATGAAGATGAGACAA

GCAATCTTATCTGGTGTGATGCTGCTGTTCAGCAGGAGAAGATTACAGACCTGCAGAACTACCAG AGAATCAACCATTTTCCAGGAATGGGAGAGATCT

GTAGGAAGGATTTCTTAGCAAGAAATATGACGAA AATGATCAAGTCTCGGCCTATGGATTATACCTTTGTTCCGAGAACGTGGATTTTCCCTTCTGAAT

ATACTCAGTTCCAAAACTATGTGAAAGAATTGAAGAAAAAACGGAAGCAGAAAACTTTTATAGTAAAACCAGCTAATGGTGCAATGGGTCATGG GATTT

CATTGATAAGAAATGGGGATAAAGTCCCTTCTCAGGATCATTTGATAGTTCAAGAATACATTGAGAAACCTTTCCTAATGGAAGGCTACAAGTTTGACTT

ACGGATTTATATTTTGGTTACATCCTGTGATCCATTAAAGATATTTCTCTACCATGATGGGCTTGTGCGCATGGGCACTGAGAAGTACATCCCACCAAAC

GAGTCCAACTTG ACCCAGTTATACATGCATCTGACCAACTACTCAGTGAACAAACACAATGAACGGTTTGAGCGCAATGAAACTGAAGACAAAGGCAGC

AAGCGGTCAATCAAGTGGTTTACGGAATTCCTACAGGCCAATCAACATGATGTCACTAAGTTCTGGAGTGATATTTCA GAGTTGGTGGTAAAGACTCTG

ATTGTGGCAGAACCTCACGTCCTGCACGCCTACCGGATGTGCAGACCCGGTCAGCCCCCCGGGAGCGAAAGTGTCTGCTTCGAAGTCCTGGGGTTCGACA

TCTTGTTGGATAGAAAGCTCAAGCCATGGCTTCTGGAG ATTAATCGAGCCCCAAGCTTTGGAACTGATCAGAAAATCGATTATGATGTTAAAAGGGGGG

TTCTGCTAAACGCGCTGAAGCTGCTGAACATCAG GACCAGCGATAAAAGGAAAAACTTGGCCAAGCAAAAAGCGGAGGCTCAGAGGAGGCTGTACGGTC

AAAACCCAGTAAGAAGGCTTTCGCCAGGCTCCTCCGACTGGGAACAGCAGAGGCACCAGCTGGAGAGGCGGAAAGAAGAGTTG AAAGAGAGACTCCTTC

AAGTACGAAAGCAGGTTTCGCAGGAAGAACATGAAAACCGACATATGGGGAATTACAG GAGAATTTATCCTCCTGAAGACAAAGCACTGCTTGAGAAGT

ATGAAGGTTTGCTGGCCGTCGCCTTCCAGACCTTCCTCTCGGGAAGAGCAGCTTCATTCCAGCGAGAAATGAACAATCCTCTGAAAAAGATGCGG GAGG

AAGATCTCCTGGATCTTCTGGAGCAGTGCGAAATCGATGATGAAAAGCTGATGGGGAAAACCGGCCGGGTCCGAGGACCGAAG CCCCTGTGCTGCATGC

CAGAGTGTGCAGAGGTCACGAAGAAGCAGAAGTATTACGGTAGCAGTGACAGCAGCTACGACAGCAGCAGCAGCAGCAGCAATTCAGAGCTGGATGAGAA

CGAAAAAGAGCTGTGTCAGAAGAGACTAGACCAAGTCCCATATAGCCTTAAGCACACCAGTCACTGCAAGATAATCCAGCAATCCAGTAAGTCAATCTCT

CCTACATCGTTAGAGGAAGAACTATAGAACTGAAACTCTTGAACTCAATAAAAAGTCCGTGGGCC
Translation
 - UNI28266 - MPSLPQDGV - UNI28266 - VIQGSSPVDLGTELPYQCTMKRKVRKKKKKGIITANVAGTKFEIV VRLVIDEMGFMKTPDED

ETSNLIWCDAAVQQEKITDLQNYQ RINHFPGMGEICRKDFLARNMTK KMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAM

GHG GISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNL TQLYMHLTNYSVNKHNERFERN

ETEDKGSKRSIKWFTEFLQANQHDVTKFWSDIS ELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLE INRAPSFGTDQK

IDYDVKRGVLLNALKLLNIR RTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPGSSDWEQQRHQLERRKEEL KERLLQVRKQVSQEEHENRHMGNYR RR

IYPPEDKALLEKYEGLLAVAFQTFLSGRAASFQREMNNPLKKMR EEDLLDLLEQCEIDDEKLMGKTGRVRGPK PLCCMPECAEVTKKQKYYGSSDSSY

DSSSSSSNSELDENEKELCQKRLDQVPYSLKHTSHCKIIQQSSKSISPTSLEEEL
Transcript ENSMUST00000037942
Sequence
GCTCACTTACCTTCCAGAGGGGATGTGCGCCCCTTTTCTTCTCAACAAGTGATACCATTAGCAAGACCAACGTCAGCGTCCCGGTCACATTCCTTAAACC

GCGCTTCATCCTACGCGAGACACCTGCCTCACGGCAGTGACACCGGCTCTACCAACACTCTG AACGAGTCTTTGCGGCAATTGAAAACCAAAGAGCAGG

AAGACGACCTCACCAGTCAGACCTTGTTTGTCCTCAAGGACATGAGAATCCGCTTTCCGGGGAAGTCAGACGCAGAGTCGGAGCTCCTGATAGAAGAT A

TCATGGATAACTGGAAGCATTATAAAACAAAAGTGGCTTCATATTGGCTCATAAAATTGGACTCTGTAAAACAACGGAAA GTTTTGGACATAGTAAAAT

CAAGTATTCGTACAGTTCTTCCAAGAATCTGGAGGGTCCCTGATGCTGAAGAACTGAGTTTATACCGGATTTTCAACAGGGTATTTAATCGCCTACTCTG

GAGTCATGGCCAAGGACTGTGGAGCTGTTTCTGTGATTCAGG ATCCTCTTGGGAGAGCATCTTCAGTAAGAGCCCTGAGGTGGTGACCCCTCTGCAGCT

CCAGTGCTGCCAGCGCCTGGTGGAGCTTTGCAAGCAGTGCCTGCTGGTGGTTTACAAATACACAACAGAAACAAGAGGACCCATCTCAGGCATCGGTCCT

GACTGGGGGAACTCCAG GTATTTGCTACCAGGAAGTACCCAATTTCTTATGAGATCACCACTGTACAACATGAAATATAATTCACCCGGAATGACTCGC

TCCAATGTTTTGTTTACGTCCCGCTATGGCCGTTTGTGAATGGAAGATTGCCATGGGCTCGCTTAATAGCAATTCATTTATTTTCTCCAGTTGAACCTTA

AGGAAGTGACCCTTATATGCTGTTTTATGTATATATGTCATAGAAGTGTGTGAAGTACATACACACAGGCACTCAAGTAACATATAAATATATATATTTA

TTATATGTAAGAAGAATTAGCAGAAAACTGAATATAAGATTTAACCTTTCTGGAAATGTAATAAACCATGTTAAAGTTGTTTACACAAATACGCAAATGT

GTAGAATTTGCTAGGTTTATAATTAATTACTTCCTACTAGAAATGTTATTTTTGCTGCAGAGTCGATCCTGAAGCTCCCATCATGGCGTTATAAATTATT

TTCTAGATAATAGGGCTTTCGACTTGAGAAAACACTGATAGTATCTTATTACCTTTCTCACTATTAGTAGTTATTTAACAGTGAAACAGAAGACTTAGAT

GCCTGGGGTTGGCTTGATGATCAGATTAGGATCAAACAGATTTGTTGTTACTATAGCACACTGTAAAGTACTAGAAAATAGCCCAGCCTGACTCTCCAAC

ATTTTACTCCCCTAGGTGGGAATTTAGCTGCTTATTCTAGTGCACATGTTCAATAAAGGTCTGGTAAGATCATGAATCATGCAAAAATGAGAGGCAACCC

AGTGGATTAAGAGTAAAATGCAAACATGCTTTAATTCGACTCTTCATGGGGAGTCCCATAGAGAAGCAAGACGATGGCAGGGACAGAAATTTGGTTGTGT

GACTTCTGTGTCACTTTCTTTTGGAAAGTATATCATTGATGGGCCCAAGTCTCTCAACATTGAGACCAATTTACCTCGCAAAGTCCAATAAGAGTAGTTT

CTCATTTCACCCCAGAAAAGACTCCGAAGAGAAGAGTCCAGTGAGTCCCATTGCTCATCGGTGTCATCTGTTGGGAGTCTATATTCAAAGTTCTGTATAA

AGTTGTCTTCCTGTCCAGAGGATTCATGCTTGTTTTTCAGACCATCATGCTCTCATTCTGCTTCATCTTCCTTGCCATCTGAAAACCAGTGTGTGCTCTC

GGTTTTCCATACAAATAGAGACATATGCCCTATGGATTCTTGAACTCAGAAAATACAATATTTGCTGAAACTTCCCTCCAGTGATTTTACTCATACATGT

TAAGTTTCTGCAAAACTCAGAATATTTGCCAGCTTCTTATATTTTTACGTTTGTTCCCCATAAATGAAGAAAGGACCCCAAAGCAGTAAGAGGTCATTTG

GCCTGGTCTCATTCGAAGCTGGATGGATGGTGACCCGAAATTGTAAGATTTAAGTATTTTGCTTTAAAAACTACCTTGGGAGAGTATACTTTTAAACTGT

AATATTCATTTATCACACACATTACCGGCAGCTACTTAAGTTCTTTATGGCTGCCTACCCACATGCATTCCAGTAGAGACTTTTTTTTACTGGCAACATC

CCATGGAATTTTGTGTTATGTTTTTGAAAGAGAATAAAGCCTCCAGATCAAGCAGATGAGTGAGTGTGGTACTTAGGAGTCCATATTGTGGATTCTTCAA

CATGGCAGAGAGTTCTTAGAATCACTGATGCAAATACTGGAACACTTCAGGATTTTTATGGAAATAATAAACAAAGCAGCCCCTTTTGGGGTTTATTTGT

AGCCATATTTGTTTTCAATTCATGATTTAAAAATCAAGGAGGAATAAAAGAAGAAACACAAAAGTCATGGATATGTCACTTAAAATGACTGATAAGTGAT

ACCAACCCAGTTTGTTGGCCATTCACTTTGTCTTAAATCACAAATGATCATTTACTCAGATAGAGTATATACTCTGAAACTTCTGTCACATACTAGGAAG

GAATTTTCATTTTAAAAAAGGCGAGGGGAGATGTCCACATTAGGAATTCTCACCCTAGAAACACACATTAAAAGCTAAGAGTAAATGGAAATAGAAAGAC

TGCCAAGCATTTGTGAAAGGCCATTATTTCCTTATCTATCCAAGCAAGGCCTTGTTTTGAGCACTGGAATTTCATTGCCTACATTTTCCTGTTGGGACAA

GTTGGGTAGGGTGAAGTGGTGCAGGAAGCTGTGTGCTCATTATTTATGTGCATTACCTGGGGTGCTGTGGACTGTGGTTGTCATAGCACCATCCCCTAAT

GAGCAGCCACGGGAAGACATGATAATGAACCGTGGAAGTCTCAGGAGGCCACAGACAGGTAGTAGGGGTATAGAATATTCCTTAGCTTTTATCAATTTCT

TATGCTTATGCTTAAAACACATCTGCAGCAGAGACAGTGTAAATCTTTAATAGAAGAGAAGGAAAATTCCAGAAGCTAGTTAATTTCACCAGGGTGTTTG

TTTGTTTGTTTGTTTGTTTGTTTGTTTGTTTTTCCTTAGAATGGATTTTGGTTTACCTACAAGGAAAGGAATGAGTATAGACCTGCAGTATAGATGGCTG

TTTGGTTCATGGCCAGGTAGAAATGCTTCCCCAAACTAAGATACAGATGTCACCCCAATTGTCTAAGTAGTAACTTGCTTGTTAGTTTGTCCTCACCCAC

AAACAGAATCTAAAGGAACAGTTTAGTTTTCACTCGAGTAAGCCAGCCTTGAAGGTTTGAATCTGGTAAAAGACCCTGTTGCAATATGAGTATTAAGTTG

TATATGGAGCACAGGGGAAGCAACTCCGTTGTCTGTAAAATGCCAGGGTTTGCCTAGATTAGATGAAGTTTTTGTTACTTGTCTCTAAAGTTCAAACCAA

ACCAAAACCAAAGCCCTTTCTTTCACCTGCTATTTATGCATACATAGAGAACAAGTGCCTCCCAGACATCAGGAAAATGATTTTCTTCAAATTCTCTCGT

TAGCTTGGATAGTAGATGAGACTGGGATCATGCGATGTGAAATTGTAGATATCTGAATAGGAATTCAATGCTTTCTTCCTTAACATGTCAATGATATTCT

GTGTAAACATTATCTTCAATATGCAATACACACTATTC
Translation
AHLPSRGDVRPFSSQQVIPLARPTSASRSHSLNRASSYARHLPHGSDTGSTNTL NESLRQLKTKEQEDDLTSQTLFVLKDMRIRFPGKSDAESELLIED

 IMDNWKHYKTKVASYWLIKLDSVKQRK VLDIVKSSIRTVLPRIWRVPDAEELSLYRIFNRVFNRLLWSHGQGLWSCFCDSG GSSWESIFSKSPEVVT

PLQLQCCQRLVELCKQCLLVVYKYTTETRGPISGIGPDWGNSR RYLLPGSTQFLMRSPLYNMKYNSPGMTRSNVLFTSRYGRL

For any suggestions or comments, please send an email to unitrap@crg.es