Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036768 (Kif15)
Chromosomal location
Chr 9: 122860182 - 122927843 (+)
Description
kinesin family member 15 Gene [Source:MGI Symbol;Acc:MGI:1098258]
RefSeq_dna
NM_010620 
RefSeq_peptide
NP_034750.1 
UniGene
Mm.278920 
MGI
MGI:1098258 
Uniprot/SWISSPROT
Q6P9L6 
Human Ortholog
ENSG00000163808 (KIF15)
Omim not available
UniTrap UNI8798
Vector Insertion
Chr 9: 122860271 - 122868234
Public Clones RRC175 (baygenomics) TEA043 (baygenomics) (ggtc) A008A08 (ggtc)
IST11684B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22966
Vector Insertion
Chr 9: 122868278 - 122868924
Public Clones not available
Private Clones OST280040 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1689
Vector Insertion
Chr 9: 122872675 - 122875066
Public Clones CF0759 (sanger) XH853 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7599
Vector Insertion
Chr 9: 122884947 - 122886957
Public Clones RRR440 (baygenomics) IST13818F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12188
Vector Insertion
Chr 9: 122894042 - 122895262
Public Clones A043D03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38501
Vector Insertion
Chr 9: 122897142 - 122900203
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8040
Vector Insertion
Chr 9: 122913812 - 122916431
Public Clones XL528 (baygenomics) RRJ126 (baygenomics)
Private Clones OST437482 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30155
Vector Insertion
Chr 9: 122926837 - 122927185
Public Clones D098E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040717
Sequence
CAAATCTGCGGCCATCTTGAAGGGAGGATTCTGGTGGTCCTGGCGTAAGCGAATCTCGGACGGGGTCGCCATGGCCCCCGGCTGCAAAT - UNI8798 

- CTGAGTTACGGAATGTGACAAATTCTCATTCTAACCAGCCAAG - UNI22966 - TAATGAAGGTGACGCTATCAAAGTTTTTGTGCGAATTCGTC

CTGCTGAAGAGGGCGCCAGATCAGCGGATGGAGAGCAGAGCTTTTGCTTATCTGTGCTCTCCCAGACCACTCTCCGGCTACACTCCAACCCAGACCCCAA

GACTTTTGTATTTGATTATGTTGCAGGCATGGACACCACTCAG GAGTCTGTATTCTCAACAGTGGCTAAAAGCATTGTGGAATCATGCATGAGCGGTTA

TAATGGGACCATCTTTGCATA - UNI1689 - TGGGCAGACTGGCTCTGGGAAGACATTTACTATGATGG GACCATCAGACTCTGATAATTTTTCTC

ATAATCTGAGAGGAATAATTCCACGAAGTTTTGAATATTTGTTTTCCTTAATTGATCGTGAAAAAGAAAAG GCTGGAGCTGGGAAGAGTTTCCTTTGTA

AGTGCTCCTTTATTGAGGTCTACAATGAGCAGATATATGACCTCCTGGACTCGGCGTCAGTCGGACTGTATTTGAGAGAGCACATAAAGAAGGGAGTCTT

TGTGGTCGGTGCAGTGGAGCAGGCGGTGACCTCAGCTGCCGAGACCTACCAG - UNI7599 - GTCTTATCTAGAGGCTGGAGGAACAGACGTGTAGC

ATCAACATCTATGAACAGAGAGTCTTCTAGATCCCATGCAGTCTTTACCATCACAATAGAATCAATGGAGAAGAGCAGCGAGACCGTGAACATCCGGACC

TCCTTACTCAACCTGGTGGACTTAGCAGGATCTGAGAGGCAAAAAGACACCCATGCAGAAGGGATGAGGCTGAAG GAGGCAGGTAACATAAACCGATCG

CTGAGCTGCCTGGGCCAAGTCATCACTGCCCTTGTTGATGTGGGTAATGGAAAACAGAGGCATATCTGCTACAGAGACTCCAAACTTACCTTCTTACTTC

GG GACTCCCTTGGTGGCAATGCCAAAACAGCTATAATTGCAAATGTTCATCCAGGATCCAGGTGTTTTGGAGAAACACTGTCAACACTTAATTTTGCTC

AAAGAGCCAAGCTGATTAAAAACAAG GCTGTGGTAAATGAAGACACCCAAGGAAATGTCAGCCAACTGCAAGCTGAAGTGAAAAGGCTCAAAGAACAAC

TGTCTCAATTTACTTCTGGGCAGATAACACCAGAAAGCTTATTGGCCAGAG - UNI12188 - ATAAAGAGAAGACTAATTACATAGAATATTTCCTG

GAAGCAATGTTATTCTTTAAGAAATCTGAACAGGAAAAAAAG TCTCTAATAGAAAAAATTACCCAACTAGAAGATCTCACCCTCAAAAAGGAAAAATTT

ATTCAGTCTAATAAAATGATTGTGAAGTTCCGGGAGGACCAAATCATGCGTCTAGAGAGGCTCCATAAGGAGGGTCGAGGAAGCTTCCTGCCGGAGGAGC

AGGATCGCCTGCTGTCAGAGCTGCGGGATGAGGTCCAGACGCTTCGAGAGCAC GTGGAGCACCATCCTAGACTTGCAAAGTATGCTATGGAAAACCATT

CCCTCAGGGAAGAGAATAGAAGACTGAAGTTACTAGCACCCGTAAAAAGAGCCCATGAAATCGATGCCCAGTCTATTGCAAGACTAGAAAAAGCTTTCGC

TGAAGTGTCTAGCACAGAGACAAATGACAAAG GTCTGCAAGGATTTTCTCCCAAAGCACTAAAAGAATCAAGTTTCTTCACAAACACCGAGAAGTTAAA

AGCACAACTCCTGCAAATTCAGACAGAACTGAATAATTCAAAGCAAGAATATGAAGAATTCAAAGAATTAACTCG GAAAAAGCAGCTAGAGCTAGAATC

AGAGCTTCAGTCTTTGCAAAAAGCAAACCTCAATCTTGAAAACCTTTTGGAGGCAACAAAAGTCTGCAAACGCCAGGAAGTTTCCCAGCTGAATAAACTA

CATGCTGAAACACTCAAG ATAATTACCACTCCAACCAAGGCTTATCAACTTTGTTCTAGACTAGTACCAAAGTCAAGCCCTGAGGTGGGGAGCTTTGGC

TTTCTGTGCACAGAGAGCTCTAGCAGGCTGGATAATGATATATTAAATGAACCAGTGCCACCTGAGATGAGTGAGCAAGCTCTGGAGGCCGTTTCAGAGG

AGCTTCGAACTGTGCAG GAACAACTGAGTGTTCTTCAAGTGAAGCTGGATGAAGAAGAACGTAAAAACCTGAAACTTCAACAGAATGTTGACAAGCTAG

AACACCATTCTACACAAATGCAGGAG CTTTTCTCATCAGAAAGAAGCGATTGGACCAAACAACAGCAAGAGCACGTCACACAGCTGAGTGACCTGGAAA

AGCAGCTGCAGGATGCTCAGACTAAGAATGAGT TTTTGAAATGTGAGGTGCATGACCTGCGAATTGTTCTTAATTCTGCTGACAAAGAACTTTCTTTGG

TGAAACTGGAGTATAGCACATTCAAAGAGAATCACGAGAAAGAACTAAGCCAGCTTTCTGAAAGACATGTGCAGGTTCAGCTTCAGCTGGACAACGCCAG

 ATTAGAAAATGAAAAACTTCTTGAGAGCCAAGCCTGTCTACAGGATTCCTACGATAACTTACAAGAAGTAATGAAATTTGAAATCGACCAACTTTCAAA

AAATCTCCAAAACTGCAAACAAGAAAATGAAACTTTAAAGTCTGATCTGCAT AATTTGGTGGAGCTTTTTGAAGCAGAAAAAGAACGCAACAACAAATT

GTCATTACAATTTGAAGAAGATAAAGAAAACAGCTCTAA AGAAATCTTAAAGGTTCTTGAAACTGTACGTCAGGAAAAACAGAAAGAGATGGCCAAGTG

TGAAAAGCAG ATGGCAAAAATACAGAAACTAGAAGAAAGCTTGCTTGCTACTGAAAATGTTATCAGCTCTCTGGAAAAGTCTAGAGAGTCTGACAAG G

AACTTGTCACCAACCTCATGAACCAAATCCAGGAGTTAAGAATATCAATTGGTGAAAAATCAGAAACCATAGCCACCCTGAAACAAGAACTTCAAGACAT

AAAT TGCAAATACAATGCTTCATTGGCTGACAAAGAAGAGAGCAAGGAATTGATCAGGAGACAGGAAGTGGATATCCTGGAACTGAAAGAAACTCTTAG

ACTGAGAATCCTCTCAGAGGACATCGAG - UNI8040 - AGGGACATGCTCTGTGAAGATCTGGCCCATGCCACTGAGCAGCTGAACATGCTCACGGA

GGCTTCCAAGAAGCACTCTGGACTGCTGCAGTCTGCTCAAGAGGAGCTGACCAGGAAGGAGGCGCTGATCCAGGAACTGCAACACAAG TTAAACCAGGA

GAAGGAGGAAGTGGAGCAGAAGAAGAATGAGTTCAGCTTGAAGATGAGGCAGCTGGAGCACGTGATGGGCTCTGCTACCGAGTATCCACAG AGTCCCAA

AACACCACCCCATTTTCAAGCTCATTTGGCAAAACTCTTGGAAACACAAGAACAAGAGATAGAAGATGGAAGAGCCTCTAAGACTTCTTTGCAACACCTT

GTAACAAAGCTAAATGAAGATAGAGAAGTCAAAAATGCTGAAATTCTCAGAATGAAG GATCAATTGTGTGAAATGGAAAATCTACGCCTGGAGTCTCAG

CAATTAAGAGAGAAAAACTGGCTCCTGCAACGTCAGCTGGATGATGTGAAAAGGCAGCAGGAGAGTGG CGATCAGAGTCATCCAGACAGTCAACAGCTG

AAGAATGAACATGAAGAGATTATCAAAGAAAGACTTGCTAAG AATAAACTTATTGAAGAGATGCTGAAAATGAAAACAAA TCTAGAAGAAGTCCAGAG

TGCACTTCACAGCAAGGAGAAGGCCTGCCACAGAATGAGTGAGGAAATTGAGCGAACCAGAACTTTGGAGTCTAGAGCATTTCAGGAAAAGGAGCAACTG

CGGTCAAAGTTGGAAGAAATGTATGAAGAAAGAGAGAGAACTTTCCTG GAAATGGAAATGCTGAAAAAGCAACTAGAATTTCTTGCTGAGGAAAATGGA

AAATTGGTAGGTCATCAAAACCTACATCAGAAGATTCAATATGTAGTACGACTGAAGAAGGAAAATATCAGGCTTACTGAG - UNI30155 - GAGAC

AGAAAAATTGCGTGCTGAAAATCTATTTTTGAAAGAAAAAAAGAAGGAATTCTAAGGATCCCAGCTATCTTCATACACATCACTTTGTTTAGATTGATTC

TTTAAAAGTGGGATTGTATTTGCTCACATGGTAGAACTAAACTAAAAGACCTTAACTATGAATCATGGTGCGCACTAATCCCGAGTGTTCCGATGGATAG

TGTGCATGCAAACTCAGCAGCCTGTTAAGTAACAATGCATTCCAAGTCATGTGTACATTCTGGAAGACCCTTAAAAGTCTGTAGCTGAGGTCTCTGGTGA

ATTCTAGTCAGGTCCTTTTCTTCTTTTTTTATTTACTTTATTTTATTTTTTTTTTTTTTGGTTTTTTGAGACAGGGTTTCTCTGTATAGCTCTGGCTGTC

TTGGAACTAACTAACTCTGTAGTCCAGCCTGGCCTCGAACTCAGAAATCTGCCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGTGTGCGCCACCACGG

CCAGTGGGTCCTTTTCTTCTTAGATTCGCCTTTGATAAACTCGCTGTGAATCCGATGGCTGTTTTGTATTGAACTTGTTCATATATATTGGTTTGTTTTG

TAACTGTTATGGCCATTTTCTACATGTCCAGTTTTTCAAATAAAATCTTTTTT
Translation
MAPGCKS - UNI8798 - SELRNVTNSHSNQPS - UNI22966 - SNEGDAIKVFVRIRPAEEGARSADGEQSFCLSVLSQTTLRLHSNPDPKTFV

FDYVAGMDTTQ ESVFSTVAKSIVESCMSGYNGTIFAY - UNI1689 - YGQTGSGKTFTMMG GPSDSDNFSHNLRGIIPRSFEYLFSLIDREKEK 

AGAGKSFLCKCSFIEVYNEQIYDLLDSASVGLYLREHIKKGVFVVGAVEQAVTSAAETYQ - UNI7599 - VLSRGWRNRRVASTSMNRESSRSHAVF

TITIESMEKSSETVNIRTSLLNLVDLAGSERQKDTHAEGMRLK EAGNINRSLSCLGQVITALVDVGNGKQRHICYRDSKLTFLLR DSLGGNAKTAIIA

NVHPGSRCFGETLSTLNFAQRAKLIKNK AVVNEDTQGNVSQLQAEVKRLKEQLSQFTSGQITPESLLARD - UNI12188 - DKEKTNYIEYFLEAM

LFFKKSEQEKK SLIEKITQLEDLTLKKEKFIQSNKMIVKFREDQIMRLERLHKEGRGSFLPEEQDRLLSELRDEVQTLREH VEHHPRLAKYAMENHSL

REENRRLKLLAPVKRAHEIDAQSIARLEKAFAEVSSTETNDKG GLQGFSPKALKESSFFTNTEKLKAQLLQIQTELNNSKQEYEEFKELTR RKKQLEL

ESELQSLQKANLNLENLLEATKVCKRQEVSQLNKLHAETLK IITTPTKAYQLCSRLVPKSSPEVGSFGFLCTESSSRLDNDILNEPVPPEMSEQALEAV

SEELRTVQ EQLSVLQVKLDEEERKNLKLQQNVDKLEHHSTQMQE LFSSERSDWTKQQQEHVTQLSDLEKQLQDAQTKNEF FLKCEVHDLRIVLNSAD

KELSLVKLEYSTFKENHEKELSQLSERHVQVQLQLDNAR RLENEKLLESQACLQDSYDNLQEVMKFEIDQLSKNLQNCKQENETLKSDLH NLVELFEA

EKERNNKLSLQFEEDKENSSK KEILKVLETVRQEKQKEMAKCEKQ MAKIQKLEESLLATENVISSLEKSRESDK ELVTNLMNQIQELRISIGEKSET

IATLKQELQDIN CKYNASLADKEESKELIRRQEVDILELKETLRLRILSEDIE - UNI8040 - RDMLCEDLAHATEQLNMLTEASKKHSGLLQSAQ

EELTRKEALIQELQHK LNQEKEEVEQKKNEFSLKMRQLEHVMGSATEYPQ SPKTPPHFQAHLAKLLETQEQEIEDGRASKTSLQHLVTKLNEDREVKN

AEILRMK DQLCEMENLRLESQQLREKNWLLQRQLDDVKRQQESG GDQSHPDSQQLKNEHEEIIKERLAK NKLIEEMLKMKTN NLEEVQSALHSKEK

ACHRMSEEIERTRTLESRAFQEKEQLRSKLEEMYEERERTFL EMEMLKKQLEFLAEENGKLVGHQNLHQKIQYVVRLKKENIRLTE - UNI30155 -

 ETEKLRAENLFLKEKKKEF

For any suggestions or comments, please send an email to unitrap@crg.es