Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036769 (Wdr44)
Chromosomal location
Chr X: 23270243 - 23383116 (+)
Description
WD repeat domain 44 Gene [Source:MGI (curated);Acc:Wdr44-002]
RefSeq_dna
NM_175180 
RefSeq_peptide
NP_780389.2 
UniGene
Mm.423 
MGI
MGI:1919654 
Uniprot/SWISSPROT
Q6NVE8 
Uniprot/SPTREMBL
B1AXB8 Q8BZS8 
Human Ortholog
ENSG00000131725 (WDR44)
Omim not available
UniTrap UNI9154
Vector Insertion
Chr X: 23270550 - 23270666
Public Clones RRE018 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8717
Vector Insertion
Chr X: 23270666 - 23309443
Public Clones XN259 (baygenomics) D130A09 (ggtc) E130A09 (ggtc) E091H03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI514
Vector Insertion
Chr X: 23309478 - 23327031
Public Clones CF0691 (sanger) CF0363 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6192
Vector Insertion
Chr X: 23347123 - 23355749
Public Clones CSG199 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101670
Sequence
GGGACGGAGAAGCGCCACAGCCTCTTCTCTAGCGCTCTCCATACACCTAGCGCCCGGGTCGCCGGCCACTGTCCCAGACCCACTGCAGCCACCTCAGGCA

GTCGCTCTGCAG - UNI9154 - GCGGAGCCGGCCCCCTCACCCGCGGGTGTGTCCTATAAATGGCGTCGGAAAGCGACACCGAAGAATTCTATGATG

CCCCTGAAGATGTGCACCTGGGGACCGGCTATCCTGTAGG - UNI8717 - - UNI9154 - GTCTCCAGGAAAAGTTGGACTTTTATCATTTAAG 

- UNI514 - GAAGCCGAGAATACAGCAAACCAAGCTGGAAATGAGTCCCCTGTACAAGAATTGAGACAAGATGTATCTAAAAAG ATAATTGAAAGTA

TTATTGAGGAAAGTCAGAAAGTACTACAATTGGAAGATGACTCTTTGGACTCCAAAGGAAAAGGACTTTCTGATGAGGCTACTGCAGGTCCTTCTGTGGC

TGGGACAGAGTTTAGTAACATACCTGGACTATTAGCCATAGAGCATGAACTACAACAAGATTCCGAAAAGGCAGAAAGTCAGAATGTAGCTGAAGAAAGT

GAACTAGAAACACAAAAATGTTTTCCTTCTGATGAGACCTGTGAGAAAAGTGAGAAGACAGTAGATGAGACTGATAATTTAACTGAAGTAAGTTCAGGTG

AGCAGCTTGATGCTTCTGGACTAGAAGCTGAAACACTGAACAAGGAAGCATTGGAAGTCAAAGAAGGTGATGTTCTAGATCCTGCCTCCTTGGACACTTT

ATCTACTACAGATTTTGCTGCTGTGGAAGAAGTGGCTCCTGCCAAACCCCCAAGGCACCTTACTCCAGAACCTGATATAGTAGCCAGTACAAAGAAGCCT

GTTCCTGCGCGCCCACCCCCACCAACTAATTTCCCGCCTCCTAGACCCCCACCTCCATCTCGACCTGCACCACCACCAAGAAAAAAGAAAAGCGAACTGG

AGTTTGAGGCTCTTAAAACACCTGATCTGGATG TACCCAAAGAAAATATTACATCTGATTCTCTGCTAACTACAAATATGGCTTCAGAGAATACAGTTA

GAGATTCCCTGCCTTCCCTCGATTTAGCAAGTGCTACCAGTGGAGATAAAATAGTAACTGCCCAG GAAAATGGAAAAGCACCTGATGTGCAGACAGTAG

CAGGTGAAGTGATGGGCCCTCAGAGACCTAGATCCAACTCTGGGAGAGAGCTTACTGATGAG GAAATTTTAGCCAGTGTCATGATTAAGAACCTGGATA

CTGGAGAAGAAATACCTTTAAGTCTTGCTGAAGAGAAGTTGCCAACAGGTATTAATCCTCTCACTCTGCACATCATGAGAAGGACAAAGGAATATGTAAG

 CAATGATGCCACACAGTCAGATGATGAAGAAAAGTTACAGTCACAACAAACAGATACTGATGGTGGAAGGTTAAAACAGAAAAC GACTCAACTAAAGA

AATTCCTTGGAAAATCAGTGAAGAGAGCAAAGCATCTTGCTGAGGAATATGGTGAACGTGCTATAAATAAAGTTAAAAGCGTAAGAGATGAAG - UNI6

192 - TGTTTCATACTGATCAAGATGACCCTTCATCAAGTGACGATGAAGGAATGCCATATACAAGACCAGTAAAATTCAAGGCAGCACATGGTTTCAA

AGGACCTTATGATTTTGATCAGATCAAAGTGGTGCAAGATCTTAGTGGTGAACACATG GGAGCTGTTTGGACCATGAAGTTTTCTCACTGTGGCCGACT

GCTTGCTTCAGCTGGACAAGACAACATAGTGAGAATATGGGCTTTAAAAAATGCTTTTGACTATTTCAACAATATGCGAATGAAATACAATACTGAAG G

ACGCGTGTCACCTTCACCATCTCAGGAAAGTCTAAGTTCATCAAAATCTGACACAGACATGGGG GTATGTAGCGGAACTGACGAAGACCCAGATGACAA

AAATGCACCGTTTCGGCAGCGACCATTTTGCAAATATAAAGGACATACTGCTGATCTCCTTGATCTTTCATGGTCTAAA AACTACTTTCTGCTCTCTTC

TTCTATGGATAAAACAGTCAGGTTATGGCACATTTCTAGAAGAGAATGCCTTTGCTGTTTTCAACATATAGATTTTGTCACTGCCATCGCTTTCCATCCA

AGA GATGACAGATATTTTCTCAGTGGATCATTGGATGGAAAGCTCCGCCTATGGAACATACCTGACAAAAAGGTGGCTTTATGGAATGAAGTAGATGGT

CAGACAAAGTTGATCACAGCTGCCAATTTTTGTCAGAATGGCAAATATGCAGTAATTGGGACATATGATGGTAGATGTATTTTCTATGATACAGAG CAT

TTGAAATACCATACACAAATACATGTACGATCTACTAGAGGACGCAACAAGGTTGGAAGAAAAATTACTGGCATTGAACCTTTACCTGGAGAAAATAAG 

ATACTGGTAACCTCAAATGACTCCAGAATCAGACTGTATGATCTGAGAGACCTATCACTGTCCATGAAGTATAAGGGTTATGTCAATAGCAGCAGCCAGA

TCAAAGCAAGTTTCAG TCATGACTTTACTTACCTCGTTAGCGGTTCAGAAGATAAATATGTTTATATCTGGAGTACGTACCATGACCTAAGCAAGTTTA

CTTCAGTCAGGAGAGATCGTAATGACTTCTGGGAAGGTATTAAAG CACATAATGCAGTTGTTACGTCAGCCATCTTTGCTCCAAACCCAAGTTTGATGC

TATCCTTGGATGTGCAATCTGAAAAATTAGAAGGGATTGATAAATATGAAGATGCTGAAGTTTTGGATAGCACATCTACTG GTATTGTGAAGACAGATA

ACACAGAAGTTCTTCTTTCTGCTGATTTTACTGGAGCAATCAAAGTGTTTATTAACAAAAGGAAAACTGTATCTTAATTTGAAATTATATTTAAAATAAA

CATATCAGTAAGTTTCTATATGTATCATAAATGAGAAAAGTATTATAGTGTTTCAGGCTAACATCCCTTTTTAGCTTTTATTGAAAGTTGTTCAAATATA

ATATATATTTTTTGAGAGGCAGTGTTAGTGATCTAGGAACTCCTAGACTGATAGACTAGAAAAGAATGTGGTTAGATTAACATTGCCAAGCATAGAGTTT

ATGTTTTGTTATGTTTATGTTTTGTTATATAATTATAAACATGCACAGGTTTCTGCATGAAAAGATATTAATATATTAATCACATGTGCGTGCCTTTTGG

TTACATGCACTAAATCTAACAAAGTTAAATTATTTTGGTGGCTCTTTTGGCCTCCTACTGGGTGAGGTGGTCTTGTTTCTAGTTCTAAAAAATTTTTTTG

CACAAAATTTCGTTTTTAAGAAATGTATCTTTTGACTGAATTATTGTTTTGAAATGTTATATAGGTTTTCAATAGGTCAATAACCATGTGTAAATGGTTT

TTTATAAATTTCTCAATTTGGGGACAAGATTTTTTTTGTGATCTAAATTGTGGACTTATTCTTTACTTTGTAAGTGTATATATATATAATTTTTTTCTTT

GCCACACTGGAGCACAATGTTTCTATGTAAAGAATTCTTTTCTTTATCCATGAGCACCAGGCTTTGCTCACTTAAAAATAAGCCACATTAAGGAGTGAGT

CTTCTTTTTTACAATAATGTAAAAATGAACTGTTTACATTTTTTTAAAGCATTGTAGTTTTTAAAAAAAAATAAGCTGTTTTGTTTTGTGTTGTTGAATT

TGAAAGGCTTTGTAAATACCAATATAATGTACCAATGAAATAACATCTGGGACAATAGAACCCTGGTAATGTTGTTGATGGTTTGCATATGTTTCTGAAA

CTGAAGTATGTATCATTAAAGTTGGTCATCAACACTTGTTAAAGGTGAAATATTTTGAGATGACATTATTAAATCAAAAGATGC
Translation
 - UNI9154 - MASESDTEEFYDAPEDVHLGTGYPVG - UNI8717 - - UNI9154 - GSPGKVGLLSFK - UNI514 - EAENTANQAGNE

SPVQELRQDVSKK IIESIIEESQKVLQLEDDSLDSKGKGLSDEATAGPSVAGTEFSNIPGLLAIEHELQQDSEKAESQNVAEESELETQKCFPSDETCE

KSEKTVDETDNLTEVSSGEQLDASGLEAETLNKEALEVKEGDVLDPASLDTLSTTDFAAVEEVAPAKPPRHLTPEPDIVASTKKPVPARPPPPTNFPPPR

PPPPSRPAPPPRKKKSELEFEALKTPDLDV VPKENITSDSLLTTNMASENTVRDSLPSLDLASATSGDKIVTAQ ENGKAPDVQTVAGEVMGPQRPRSN

SGRELTDE EILASVMIKNLDTGEEIPLSLAEEKLPTGINPLTLHIMRRTKEYVS SNDATQSDDEEKLQSQQTDTDGGRLKQKT TTQLKKFLGKSVKR

AKHLAEEYGERAINKVKSVRDEV - UNI6192 - VFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFDQIKVVQDLSGEHM GAVWTMKFSHCG

RLLASAGQDNIVRIWALKNAFDYFNNMRMKYNTEG GRVSPSPSQESLSSSKSDTDMG VCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSK NY

FLLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPR DDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIF

YDTE HLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENK ILVTSNDSRIRLYDLRDLSLSMKYKGYVNSSSQIKASFS SHDFTYLVSGSEDKYVYIWS

TYHDLSKFTSVRRDRNDFWEGIKA AHNAVVTSAIFAPNPSLMLSLDVQSEKLEGIDKYEDAEVLDSTSTG GIVKTDNTEVLLSADFTGAIKVFINKRK

TVS
Transcript ENSMUST00000035766
Sequence
ATTGGAGCTGCTGTCGCTGGCACGCCCGCTGCCTGCTCTCCGGGACGGAGAAGCGCCACAGCCTCTTCTCTAGCGCTCTCCATACACCTAGCGCCCGGGT

CGCCGGCCACTGTCCCAGACCCACTGCAGCCACCTCAGGCAGTCGCTCTGCAGGTCATCCCCTTAGCCCAGCAACTGAGGGTGGTCCCCGGTCCCGGGTT

GACTTCTCACTCCACGTCATCTGTGCCCTCCTCAGTGTCGCCCGGGGACCCACCTCTCCACACTCTTAACTGACGAGGAGGAGACGCTCAGAATCACCCT

TTCTCTAGGCGGAGCCGGCCCCCTCACCCGCGGGTGTGTCCTATAAATGGCGTCGGAAAGCGACACCGAAGAATTCTATGATGCCCCTGAAGATGTGCAC

CTGGGGACCGGCTATCCTGTAGG - UNI8717 - - UNI9154 - GTCTCCAGGAAAAGTTGGACTTTTATCATTTAAG - UNI514 - GAAGCC

GAGAATACAGCAAACCAAGCTGGAAATGAGTCCCCTGTACAAGAATTGAGACAAGATGTATCTAAAAAG ATAATTGAAAGTATTATTGAGGAAAGTCAG

AAAGTACTACAATTGGAAGATGACTCTTTGGACTCCAAAGGAAAAGGACTTTCTGATGAGGCTACTGCAGGTCCTTCTGTGGCTGGGACAGAGTTTAGTA

ACATACCTGGACTATTAGCCATAGAGCATGAACTACAACAAGATTCCGAAAAGGCAGAAAGTCAGAATGTAGCTGAAGAAAGTGAACTAGAAACACAAAA

ATGTTTTCCTTCTGATGAGACCTGTGAGAAAAGTGAGAAGACAGTAGATGAGACTGATAATTTAACTGAAGTAAGTTCAGGTGAGCAGCTTGATGCTTCT

GGACTAGAAGCTGAAACACTGAACAAGGAAGCATTGGAAGTCAAAGAAGGTGATGTTCTAGATCCTGCCTCCTTGGACACTTTATCTACTACAGATTTTG

CTGCTGTGGAAGAAGTGGCTCCTGCCAAACCCCCAAGGCACCTTACTCCAGAACCTGATATAGTAGCCAGTACAAAGAAGCCTGTTCCTGCGCGCCCACC

CCCACCAACTAATTTCCCGCCTCCTAGACCCCCACCTCCATCTCGACCTGCACCACCACCAAGAAAAAAGAAAAGCGAACTGGAGTTTGAGGCTCTTAAA

ACACCTGATCTGGATG TACCCAAAGAAAATATTACATCTGATTCTCTGCTAACTACAAATATGGCTTCAGAGAATACAGTTAGAGATTCCCTGCCTTCC

CTCGATTTAGCAAGTGCTACCAGTGGAGATAAAATAGTAACTGCCCAG GAAAATGGAAAAGCACCTGATGTGCAGACAGTAGCAGGTGAAGTGATGGGC

CCTCAGAGACCTAGATCCAACTCTGGGAGAGAGCTTACTGATGAG GAAATTTTAGCCAGTGTCATGATTAAGAACCTGGATACTGGAGAAGAAATACCT

TTAAGTCTTGCTGAAGAGAAGTTGCCAACAGGTATTAATCCTCTCACTCTGCACATCATGAGAAGGACAAAGGAATATGTAAG CAATGATGCCACACAG

TCAGATGATGAAGAAAAGTTACAGTCACAACAAACAGATACTGATGGTGGAAGGTTAAAACAGAAAAC GACTCAACTAAAGAAATTCCTTGGAAAATCA

GTGAAGAGAGCAAAGCATCTTGCTGAGGAATATGGTGAACGTGCTATAAATAAAGTTAAAAGCGTAAGAGATGAAG - UNI6192 - TGTTTCATACT

GATCAAGATGACCCTTCATCAAGTGACGATGAAGGAATGCCATATACAAGACCAGTAAAATTCAAGGCAGCACATGGTTTCAAAGGACCTTATGATTTTG

ATCAGATCAAAGTGGTGCAAGATCTTAGTGGTGAACACATG GGAGCTGTTTGGACCATGAAGTTTTCTCACTGTGGCCGACTGCTTGCTTCAGCTGGAC

AAGACAACATAGTGAGAATATGGGCTTTAAAAAATGCTTTTGACTATTTCAACAATATGCGAATGAAATACAATACTGAAG GACGCGTGTCACCTTCAC

CATCTCAGGAAAGTCTAAGTTCATCAAAATCTGACACAGACATGGGG GTATGTAGCGGAACTGACGAAGACCCAGATGACAAAAATGCACCGTTTCGGC

AGCGACCATTTTGCAAATATAAAGGACATACTGCTGATCTCCTTGATCTTTCATGGTCTAAA AACTACTTTCTGCTCTCTTCTTCTATGGATAAAACAG

TCAGGTTATGGCACATTTCTAGAAGAGAATGCCTTTGCTGTTTTCAACATATAGATTTTGTCACTGCCATCGCTTTCCATCCAAGA GATGACAGATATT

TTCTCAGTGGATCATTGGATGGAAAGCTCCGCCTATGGAACATACCTGACAAAAAGGTGGCTTTATGGAATGAAGTAGATGGTCAGACAAAGTTGATCAC

AGCTGCCAATTTTTGTCAGAATGGCAAATATGCAGTAATTGGGACATATGATGGTAGATGTATTTTCTATGATACAGAG CATTTGAAATACCATACACA

AATACATGTACGATCTACTAGAGGACGCAACAAGGTTGGAAGAAAAATTACTGGCATTGAACCTTTACCTGGAGAAAATAAG ATACTGGTAACCTCAAA

TGACTCCAGAATCAGACTGTATGATCTGAGAGACCTATCACTGTCCATGAAGTATAAGGGTTATGTCAATAGCAGCAGCCAGATCAAAGCAAGTTTCAG 

TCATGACTTTACTTACCTCGTTAGCGGTTCAGAAGATAAATATGTTTATATCTGGAGTACGTACCATGACCTAAGCAAGTTTACTTCAGTCAGGAGAGAT

CGTAATGACTTCTGGGAAGGTATTAAAG CACATAATGCAGTTGTTACGTCAGCCATCTTTGCTCCAAACCCAAGTTTGATGCTATCCTTGGATGTGCAA

TCTGAAAAATTAGAAGGGATTGATAAATATGAAGATGCTGAAGTTTTGGATAGCACATCTACTG GTATTGTGAAGACAGATAACACAGAAGTTCTTCTT

TCTGCTGATTTTACTGGAGCAATCAAAGTGTTTATTAACAAAAGGAAAACTGTATCTTAATTTGAAATTATATTTAAAATAAACATATCAGTAAGTTTCT

ATATGTATCATAAATGAGAAAAGTATTATAGTGTTTCAGGCTAACATCCCTTTTTAGCTTTTATTGAAAGTTGTTCAAATATAATATATATTTTTTGAGA

GGCAGTGTTAGTGATCTAGGAACTCCTAGACTGATAGACTAGAAAAGAATGTGGTTAGATTAACATTGCCAAGCATAGAGTTTATGTTTTGTTATGTTTA

TGTTTTGTTATATAATTATAAACATGCACAGGTTTCTGCATGAAAAGATATTAATATATTAATCACATGTGCGTGCCTTTTGGTTACATGCACTAAATCT

AACAAAGTTAAATTATTTTGGTGGCTCTTTTGGCCTCCTACTGGGTGAGGTGGTCTTGTTTCTAGTTCTAAAAAATTTTTTTGCACAAAATTTCGTTTTT

AAGAAATGTATCTTTTGACTGAATTATTGTTTTGAAATGTTATATAGGTTTTCAATAGGTCAATAACCATGTGTAAATGGTTTTTTATAAATTTCTCAAT

TTGGGGACAAGATTTTTTTTGTGATCTAAATTGTGGACTTATTCTTTACTTTGTAAGTGTATATATATATAATTTTTTTCTTTGCCACACTGGAGCACAA

TGTTTCTATGTAAAGAATTCTTTTCTTTATCCATGAGCACCAGGCTTTGCTCACTTAAAAATAAGCCACATTAAGGAGTGAGTCTTCTTTTTTACAATAA

TGTAAAAATGAACTGTTTACATTTTTTTAAAGCATTGTAGTTTTTAAAAAAAAATAAGCTGTTTTGTTTTGTGTTGTTGAATTTGAAAGGCTTTGTAAAT

ACCAATATAATGTACCAATGAAATAACATCTGGGACAATAGAACCCTGGTAATGTTGTTGATGGTTTGCATATGTTTCTGAAACTGAAGTATGTATCATT

AAAGTTGGTCATCAACACTTGTTAAAGGTGAAATATTTTGAGATGACATTATTAAATCAAAAGATGC
Translation
MASESDTEEFYDAPEDVHLGTGYPVG - UNI8717 - - UNI9154 - GSPGKVGLLSFK - UNI514 - EAENTANQAGNESPVQELRQDVSKK

 IIESIIEESQKVLQLEDDSLDSKGKGLSDEATAGPSVAGTEFSNIPGLLAIEHELQQDSEKAESQNVAEESELETQKCFPSDETCEKSEKTVDETDNLT

EVSSGEQLDASGLEAETLNKEALEVKEGDVLDPASLDTLSTTDFAAVEEVAPAKPPRHLTPEPDIVASTKKPVPARPPPPTNFPPPRPPPPSRPAPPPRK

KKSELEFEALKTPDLDV VPKENITSDSLLTTNMASENTVRDSLPSLDLASATSGDKIVTAQ ENGKAPDVQTVAGEVMGPQRPRSNSGRELTDE EILA

SVMIKNLDTGEEIPLSLAEEKLPTGINPLTLHIMRRTKEYVS SNDATQSDDEEKLQSQQTDTDGGRLKQKT TTQLKKFLGKSVKRAKHLAEEYGERAI

NKVKSVRDEV - UNI6192 - VFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFDQIKVVQDLSGEHM GAVWTMKFSHCGRLLASAGQDNIVR

IWALKNAFDYFNNMRMKYNTEG GRVSPSPSQESLSSSKSDTDMG VCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSK NYFLLSSSMDKTVRL

WHISRRECLCCFQHIDFVTAIAFHPR DDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDTE HLKYHTQI

HVRSTRGRNKVGRKITGIEPLPGENK ILVTSNDSRIRLYDLRDLSLSMKYKGYVNSSSQIKASFS SHDFTYLVSGSEDKYVYIWSTYHDLSKFTSVRR

DRNDFWEGIKA AHNAVVTSAIFAPNPSLMLSLDVQSEKLEGIDKYEDAEVLDSTSTG GIVKTDNTEVLLSADFTGAIKVFINKRKTVS

For any suggestions or comments, please send an email to unitrap@crg.es