Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036782 (Klhl13)
Chromosomal location
Chr X: 22796397 - 22942208 (-)
Description
kelch-like 13 (Drosophila) Gene [Source:MGI (curated);Acc:Klhl13-001]
RefSeq_dna
NM_026167 
RefSeq_peptide
NP_080443.1 
MGI
MGI:1914705 
Uniprot/SWISSPROT
Q80TF4 
Uniprot/SPTREMBL
A2AL86 Q9CSA7 A2AL87 A2AL88 A2AL89 Q497T4 
Human Ortholog
ENSG00000003096 (KLHL13)
Omim not available
UniTrap UNI2640
Vector Insertion
Chr X: 22892334 - 22938619
Public Clones DD0849 (sanger) (sanger) GST044 (baygenomics) RRJ678 (baygenomics) RST450 (baygenomics)
3SP105D04 (ggtc) P010D02 (ggtc) 5SD022H11 (ggtc) P128B08 (ggtc)
5SP105D04 (ggtc) P078H08 (ggtc) IST13635D6 (tigm) IST13053E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12149
Vector Insertion
Chr X: 22892255 - 22892328
Public Clones W251D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2401
Vector Insertion
Chr X: 22862364 - 22892255
Public Clones AC0655 (sanger) XT0586 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23895
Vector Insertion
Chr X: 22838700 - 22843810
Public Clones not available
Private Clones OST241124 (lexicon) OST194454 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20187
Vector Insertion
Chr X: 22825371 - 22838560
Public Clones not available
Private Clones OST369935 (lexicon) OST201446 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7432
Vector Insertion
Chr X: 22813148 - 22824486
Public Clones RRS761 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8116
Vector Insertion
Chr X: 22805814 - 22812351
Public Clones RRG185 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115313
Sequence
TTATCCCCCACCCCCTGGTGAGGTCAGGCGGAGGCTCTGCCGCTGCGGCCGCAGCAGCTCAGCTCCCATTCCCAGGCAGCTTGGAACAGGGACTTTGGCA

AATAACTGGAGCGGCGTTCGGGTTAGG TTCTGAGGCCTTCAGACTGGGACTGAGCTCCACCGCCAGCATCTCCGACAGCTTTCAGACTGCCGTGGGCCT

TCTCTGTTGCCGCGACTCT - UNI2640 - - UNI12149 - GTCTGCTCAACCCTGAGAAGTGATGGATATTCTTCACAGAGGAGAATTGGTTGCT

GCAATACTCCGCAACCG - UNI2401 - - UNI12149 - - UNI23895 - ATCACTTGTGGAAGAGGAAGACCAGCACTTGAAACTGTGCCTTG

GAAGTGAAATGGGCCTCTCTTCCCATTTGCAGTCTTGCAAGGCAGGAAGTACACGCATCTTTACCAGCAACAGCCACAGTTCTGTGGTGTTACAG - UN

I20187 - GGCTTTGACCAGCTTCGGCTTGATGGATTGCTTTGTGATGTGACACTGATGCCAGGTGATACAGATGATGCTTACCCTGTGCACAGAGTCA

TGATGGCATCTGCTAGTGACTACTTCAAAGCTATGTTCACAG GTGGAATGAAAGAACAAGAGCTGATGTGCATTAAGCTTCATGGCGTGAGCAGAGTGG

GTCTACGGAAAATTATTGATTTCATCTATACTGCAAAGCTTTCTCTTAACATGGACACCCTTCAGGATACGCTGGAAGCCGCCAGCTTTCTTCAGATTCT

TCCGGTTTTAGACTTCTGCAAAGTGTTTCTCATATCTGGG - UNI7432 - GTCACTTTGGATAACTGTGTTGAAGTTGGACGGATTGCCAACACCTA

CCATCTGACAGAAGTGGATAAATATGTCAACAGCTTCGTCTTAAAGAATTTTGCTGCATTGCTGAGCACTGGGGAGTTCCTGAAGCTTCCCTTCGAGCGC

CTTGCCTTTGTCCTGTCCAGCAACAGCCTTAAGCGCTGCACCGAACTTGACCTCTTCAAAGCTACCTGTCGCTGGCTTCGCCTGGAAGAACCTAGAATGG

ACGTTGCTGCAAAACTAATGAAGAATATACGATTTCCGCTGATGACACCACAGGAGCTCATTAATTATGTGCAAACCGTGGATTTCATGAGAACTGACAA

TACTTGCGTCAATTTGCTTCTGGAAGCCAGCAATTACCAAATGATGCCGTTTATGCAGCCAGTTATGCAGTCAGACAGGACTGCCATTCGGTCTGACACC

ACTCGTTTGGTTACACTCGGAGGAGTCCTGAGACAGCAGCTTGTCGTCAGTAAAGAATTGCGCATGTATGATGAAAAGACCCACGAGTGGAAATCTCTAG

CCCCCATGGATGCCCCAAGATACCAGCATGGCATTGCTGTCATCGGAAATTTTCTCTACGTTGTTGGTGGGCAGAGTAATTATGACACAAAAGGAAAAAC

CGCCGTCGATACAGTGTTTAGATTTGATCCTCGATACAACAAATGGATCCAAGTTGCATCTTTAAATGAAAAGCGCACCTTCTTCCACCTAAGTGCCCTC

AAAGGATTTCTGTATGCAGTTGGTGGACGAAATGCAGCTGGAGAACTCC - UNI8116 - CTACTGTGGAATGTTACAATCCGAGAACAAATGAATGG

ACCTATGTTGCCAAAATGAATGAACCTCACTATGGCCATGCTGGAACTGTGTATGGAGGAGTGATGTATATTTCAG GAGGAATTACCCATGACACTTTC

CAAAAGGAGCTCATGTGCTTCGACCCTGATACTGACAAATGGACCCAGAAGGCACCGATGACCACTGTCCGAGGCCTACACTGCATGTGTACGGTGGGAG

ATAGGCTCTACGTCATTGGTGGCAACCATTTCCGAGGAACCAGTGATTATGATGATGTCCTGAGCTGTGAATACTACTCACCTATCCTTGACCAGTGGAC

CCCAATTGCTTCCATGTTAAGAGGGCAGAGTGATGTTGGGGTCGCTGTCTTTGAGAATAAAATCTATGTGGTTGGTGGCTATTCATGGAATAATCGCTGT

ATGGTAGAGATAGTGCAGAAGTATGATCCAGAGAAAAATGAATGGCATAAGGTTTTCGATCTGCCAGAGTCTCTTGGTGGTATTCGAGCTTGTACACTTA

CAGTTTATCCACCTGAAGAAGCCACACCATCACCTTCTAGAGAGTCCCCTCTTTCTGGACCCTAAGATCATCCTTACAATTAAGATGCTATATTCCTATC

TTTGCAATGTGTCATGATTATCTTCTTTTCCCCCCTTAAGTAGCATATATGTTAGAGTTAGCCTTCAGTAATTGATACAGAAAAAAAATTGACATTGATG

TTACTTGTGATGTTTGTATGGCCTAGAATGTTTATAAAGTGGTAACAAACCATCCTTGAAATATATCCCATAGAAGCTGATGTTTAACATGAAAACAAAA

AAAGTATTGTCTACAAAGTGTTTCTTCAGTACTTTCTAAATGCTGTGTACTGAGTGTAAGGGATTCCTCATCTTACATTATAAGCCAAGTTGAAGGTGGA

TTATAGTAAATGTACAACTGTGCTCACTAGGTTTCAAAGTGAAGAAGTTTTCCTTTCATCTTTAACTGTAAGATGTCAAAGGGAGGCAGCCTGCTCCAAT

AGGAAACAGTACACAAAAGGTTGCCAACTCGCATGAGCTACCTCCCTCTTTTCATAAAGTATTTTTGACACATCTGTCAACCCACCTGACTGTGTGGGTG

CATTGAGAACACACCAAGTTTCTAAGACACACAGGAGAAATAACTGAAATTCACCAACACTAGTTTGTGGGGGAAAGCATGACCCCTCTGCTTATAAGAA

TTGGTTTGGGGTTTTTTTTAAGTGTGTATAGATGAACACACACATACTTATATCAAATACAAATTTTTAAAAATTGACTGTCAGGTCAAATAAATGTGAA

ATTAAACAAAATTCTTCTAAAAAGCAGCTTCCATGAAAAATGGGGATTCAGTATGCACACATTAAATGCATATATTTCAAACCATACTGAATTTAGGTGG

ATAAGGGCTAGAAATTTTGAGCAACTAAATTTATCACTTGACCAAATTTTACCATAAAGAATTATATTCTCTTTTTCTCCTTTGCTGTTGAAGTAACTTA

CCTGTTGTGTGGATTCTGTATTCTGTACACTCTTGGTTCATGAGGTTATTTAGCACAAAGTGTAACAGCTTCACCTGGGAAGCTGCTTTTGCTCTATGAT

GTCCATGGTTTCCCTTCTTTTCTTCAATAAAAACATTTAATGTCATTCTGCTCTGTGCC
Translation
  - UNI2640 - - UNI12149 -  - UNI2401 - - UNI12149 - - UNI23895 - MGLSSHLQSCKAGSTRIFTSNSHSSVVLQ - UN

I20187 - GFDQLRLDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKAMFTG GGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNMDTLQDTLE

AASFLQILPVLDFCKVFLISG - UNI7432 - VTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLAFVLSSNSLKRCTELD

LFKATCRWLRLEEPRMDVAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTRLVTLGGVLRQQLVVS

KELRMYDEKTHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWIQVASLNEKRTFFHLSALKGFLYAVGGRNAAGELP

 - UNI8116 - PTVECYNPRTNEWTYVAKMNEPHYGHAGTVYGGVMYISG GGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDRLYVI

GGNHFRGTSDYDDVLSCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKNEWHKVFDLPESLGGIRACTLTVYPPE

EATPSPSRESPLSGP
Transcript ENSMUST00000115316
Sequence
ATGGAGGGAGAGTACTTCTTTGAAGAAAACCCCTTTCTTGAATTCCTTTTAAAACT - UNI23895 - ATCACTTGTGGAAGAGGAAGACCAGCACTT

GAAACTGTGCCTTGGAAGTGAAATGGGCCTCTCTTCCCATTTGCAGTCTTGCAAGGCAGGAAGTACACGCATCTTTACCAGCAACAGCCACAGTTCTGTG

GTGTTACAG - UNI20187 - GGCTTTGACCAGCTTCGGCTTGATGGATTGCTTTGTGATGTGACACTGATGCCAGGTGATACAGATGATGCTTACCC

TGTGCACAGAGTCATGATGGCATCTGCTAGTGACTACTTCAAAGCTATGTTCACAG GTGGAATGAAAGAACAAGAGCTGATGTGCATTAAGCTTCATGG

CGTGAGCAGAGTGGGTCTACGGAAAATTATTGATTTCATCTATACTGCAAAGCTTTCTCTTAACATGGACACCCTTCAGGATACGCTGGAAGCCGCCAGC

TTTCTTCAGATTCTTCCGGTTTTAGACTTCTGCAAAGTGTTTCTCATATCTGGG - UNI7432 - GTCACTTTGGATAACTGTGTTGAAGTTGGACGG

ATTGCCAACACCTACCATCTGACAGAAGTGGATAAATATGTCAACAGCTTCGTCTTAAAGAATTTTGCTGCATTGCTGAGCACTGGGGAGTTCCTGAAGC

TTCCCTTCGAGCGCCTTGCCTTTGTCCTGTCCAGCAACAGCCTTAAGCGCTGCACCGAACTTGACCTCTTCAAAGCTACCTGTCGCTGGCTTCGCCTGGA

AGAACCTAGAATGGACGTTGCTGCAAAACTAATGAAGAATATACGATTTCCGCTGATGACACCACAGGAGCTCATTAATTATGTGCAAACCGTGGATTTC

ATGAGAACTGACAATACTTGCGTCAATTTGCTTCTGGAAGCCAGCAATTACCAAATGATGCCGTTTATGCAGCCAGTTATGCAGTCAGACAGGACTGCCA

TTCGGTCTGACACCACTCGTTTGGTTACACTCGGAGGAGTCCTGAGACAGCAGCTTGTCGTCAGTAAAGAATTGCGCATGTATGATGAAAAGACCCACGA

GTGGAAATCTCTAGCCCCCATGGATGCCCCAAGATACCAGCATGGCATTGCTGTCATCGGAAATTTTCTCTACGTTGTTGGTGGGCAGAGTAATTATGAC

ACAAAAGGAAAAACCGCCGTCGATACAGTGTTTAGATTTGATCCTCGATACAACAAATGGATCCAAGTTGCATCTTTAAATGAAAAGCGCACCTTCTTCC

ACCTAAGTGCCCTCAAAGGATTTCTGTATGCAGTTGGTGGACGAAATGCAGCTGGAGAACTCC - UNI8116 - CTACTGTGGAATGTTACAATCCGA

GAACAAATGAATGGACCTATGTTGCCAAAATGAATGAACCTCACTATGGCCATGCTGGAACTGTGTATGGAGGAGTGATGTATATTTCAG GAGGAATTA

CCCATGACACTTTCCAAAAGGAGCTCATGTGCTTCGACCCTGATACTGACAAATGGACCCAGAAGGCACCGATGACCACTGTCCGAGGCCTACACTGCAT

GTGTACGGTGGGAGATAGGCTCTACGTCATTGGTGGCAACCATTTCCGAGGAACCAGTGATTATGATGATGTCCTGAGCTGTGAATACTACTCACCTATC

CTTGACCAGTGGACCCCAATTGCTTCCATGTTAAGAGGGCAGAGTGATGTTGGGGTCGCTGTCTTTGAGAATAAAATCTATGTGGTTGGTGGCTATTCAT

GGAATAATCGCTGTATGGTAGAGATAGTGCAGAAGTATGATCCAGAGAAAAATGAATGGCATAAGGTTTTCGATCTGCCAGAGTCTCTTGGTGGTATTCG

AGCTTGTACACTTACAGTTTATCCACCTGAAGAAGCCACACCATCACCTTCTAGAGAGTCCCCTCTTTCTGGACCCTAAGATCATCCTTACAATTAAGAT

GCTATATTCCTATCTTTGCAATGTGTCATGATTATCTTCTTTTCCCCCCTTAAGTAGCATATATGTTAGAGTTAGCCTTCAGTAATTGATACAGAAAAAA

AATTGACATTGATGTTACTTGTGATGTTTGTATGGCCTAGAATGTTTATAAAGTGGTAACAAACCATCCTTGAAATATATCCCATAGAAGCTGATGTTTA

ACATGAAAACAAAAAAAGTATTGTCTACAAAGTGTTTCTTCAGTACTTTCTAAATGCTGTGTACTGAGTGTAAGGGATTCCTCATCTTACATTATAAGCC

AAGTTGAAGGTGGATTATAGTAAATGTACAACTGTGCTCACTAGGTTTCAAAGTGAAGAAGTTTTCCTTTCATCTTTAACTGTAAGATGTCAAAGGGAGG

CAGCCTGCTCCAATAGGAAACAGTACACAAAAGGTTGCCAACTCGCATGAGCTACCTCCCTCTTTTCATAAAGTATTTTTGACACATCTGTCAACCCACC

TGACTGTGTGGGTGCATTGAGAACACACCAAGTTTCTAAGACACACAGGAGAAATAACTGAAATTCACCAACACTAGTTTGTGGGGGAAAGCATGACCCC

TCTGCTTATAAGAATTGGTTTGGGGTTTTTTTTAAGTGTGTATAGATGAACACACACATACTTATATCAAATACAAATTTTTAAAAATTGACTGTCAGGT

CAAATAAATGTGAAATTAAACAAAATTCTTCTAAAAAGCAGCTTCCATGAAAAATGGGGATTCAGTATGCACACATTAAATGCATATATTTCAAACCATA

CTGAATTTAGGTGGATAAGGGCTAGAAATTTTGAGCAACTAAATTTATCACTTGACCAAATTTTACCATAAAGAATTATATTCTCTTTTTCTCCTTTGCT

GTTGAAGTAACTTACCTGTTGTGTGGATTCTGTATTCTGTACACTCTTGGTTCATGAGGTTATTTAGCACAAAGTGTAACAGCTTCACCTGGGAAGCTGC

TTTTGCTCTATGATGTCCATGGTTTCCCTTCTTTTCTTCAATAAAAACATTTAATGTCATTCTGCTCTGTGCC
Translation
MEGEYFFEENPFLEFLLKL - UNI23895 - LSLVEEEDQHLKLCLGSEMGLSSHLQSCKAGSTRIFTSNSHSSVVLQ - UNI20187 - GFDQLR

LDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKAMFTG GGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNMDTLQDTLEAASFLQILPVLDFCK

VFLISG - UNI7432 - VTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLAFVLSSNSLKRCTELDLFKATCRWLRLEEPR

MDVAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTRLVTLGGVLRQQLVVSKELRMYDEKTHEWKS

LAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWIQVASLNEKRTFFHLSALKGFLYAVGGRNAAGELP - UNI8116 - PT

VECYNPRTNEWTYVAKMNEPHYGHAGTVYGGVMYISG GGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDRLYVIGGNHFRGTSDYDDVL

SCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKNEWHKVFDLPESLGGIRACTLTVYPPEEATPSPSRESPLSGP

Transcript ENSMUST00000115317
Sequence
ATGCCATTGAAATGGAAAACGAGCTCTCCTGCTATCTGGAAATTCCCAGTTCCTGTGCTTAAAACATCCAGGTCAACTCCACTTTCTCCAGCATACAT -

 UNI23895 - ATCACTTGTGGAAGAGGAAGACCAGCACTTGAAACTGTGCCTTGGAAGTGAAATGGGCCTCTCTTCCCATTTGCAGTCTTGCAAGGCA

GGAAGTACACGCATCTTTACCAGCAACAGCCACAGTTCTGTGGTGTTACAG - UNI20187 - GGCTTTGACCAGCTTCGGCTTGATGGATTGCTTTG

TGATGTGACACTGATGCCAGGTGATACAGATGATGCTTACCCTGTGCACAGAGTCATGATGGCATCTGCTAGTGACTACTTCAAAGCTATGTTCACAG G

TGGAATGAAAGAACAAGAGCTGATGTGCATTAAGCTTCATGGCGTGAGCAGAGTGGGTCTACGGAAAATTATTGATTTCATCTATACTGCAAAGCTTTCT

CTTAACATGGACACCCTTCAGGATACGCTGGAAGCCGCCAGCTTTCTTCAGATTCTTCCGGTTTTAGACTTCTGCAAAGTGTTTCTCATATCTGGG - U

NI7432 - GTCACTTTGGATAACTGTGTTGAAGTTGGACGGATTGCCAACACCTACCATCTGACAGAAGTGGATAAATATGTCAACAGCTTCGTCTTAA

AGAATTTTGCTGCATTGCTGAGCACTGGGGAGTTCCTGAAGCTTCCCTTCGAGCGCCTTGCCTTTGTCCTGTCCAGCAACAGCCTTAAGCGCTGCACCGA

ACTTGACCTCTTCAAAGCTACCTGTCGCTGGCTTCGCCTGGAAGAACCTAGAATGGACGTTGCTGCAAAACTAATGAAGAATATACGATTTCCGCTGATG

ACACCACAGGAGCTCATTAATTATGTGCAAACCGTGGATTTCATGAGAACTGACAATACTTGCGTCAATTTGCTTCTGGAAGCCAGCAATTACCAAATGA

TGCCGTTTATGCAGCCAGTTATGCAGTCAGACAGGACTGCCATTCGGTCTGACACCACTCGTTTGGTTACACTCGGAGGAGTCCTGAGACAGCAGCTTGT

CGTCAGTAAAGAATTGCGCATGTATGATGAAAAGACCCACGAGTGGAAATCTCTAGCCCCCATGGATGCCCCAAGATACCAGCATGGCATTGCTGTCATC

GGAAATTTTCTCTACGTTGTTGGTGGGCAGAGTAATTATGACACAAAAGGAAAAACCGCCGTCGATACAGTGTTTAGATTTGATCCTCGATACAACAAAT

GGATCCAAGTTGCATCTTTAAATGAAAAGCGCACCTTCTTCCACCTAAGTGCCCTCAAAGGATTTCTGTATGCAGTTGGTGGACGAAATGCAGCTGGAGA

ACTCC - UNI8116 - CTACTGTGGAATGTTACAATCCGAGAACAAATGAATGGACCTATGTTGCCAAAATGAATGAACCTCACTATGGCCATGCTGG

AACTGTGTATGGAGGAGTGATGTATATTTCAG GAGGAATTACCCATGACACTTTCCAAAAGGAGCTCATGTGCTTCGACCCTGATACTGACAAATGGAC

CCAGAAGGCACCGATGACCACTGTCCGAGGCCTACACTGCATGTGTACGGTGGGAGATAGGCTCTACGTCATTGGTGGCAACCATTTCCGAGGAACCAGT

GATTATGATGATGTCCTGAGCTGTGAATACTACTCACCTATCCTTGACCAGTGGACCCCAATTGCTTCCATGTTAAGAGGGCAGAGTGATGTTGGGGTCG

CTGTCTTTGAGAATAAAATCTATGTGGTTGGTGGCTATTCATGGAATAATCGCTGTATGGTAGAGATAGTGCAGAAGTATGATCCAGAGAAAAATGAATG

GCATAAGGTTTTCGATCTGCCAGAGTCTCTTGGTGGTATTCGAGCTTGTACACTTACAGTTTATCCACCTGAAGAAGCCACACCATCACCTTCTAGAGAG

TCCCCTCTTTCTGGACCCTAAGATCATCCTTACAATTAAGATGCTATATTCCTATCTTTGCAATGTGTCATGATTATCTTCTTTTCCCCCCTTAAGTAGC

ATATATGTTAGAGTTAGCCTTCAGTAATTGATACAGAAAAAAAATTGACATTGATGTTACTTGTGATGTTTGTATGGCCTAGAATGTTTATAAAGTGGTA

ACAAACCATCCTTGAAATATATCCCATAGAAGCTGATGTTTAACATGAAAACAAAAAAAGTATTGTCTACAAAGTGTTTCTTCAGTACTTTCTAAATGCT

GTGTACTGAGTGTAAGGGATTCCTCATCTTACATTATAAGCCAAGTTGAAGGTGGATTATAGTAAATGTACAACTGTGCTCACTAGGTTTCAAAGTGAAG

AAGTTTTCCTTTCATCTTTAACTGTAAGATGTCAAAGGGAGGCAGCCTGCTCCAATAGGAAACAGTACACAAAAGGTTGCCAACTCGCATGAGCTACCTC

CCTCTTTTCATAAAGTATTTTTGACACATCTGTCAACCCACCTGACTGTGTGGGTGCATTGAGAACACACCAAGTTTCTAAGACACACAGGAGAAATAAC

TGAAATTCACCAACACTAGTTTGTGGGGGAAAGCATGACCCCTCTGCTTATAAGAATTGGTTTGGGGTTTTTTTTAAGTGTGTATAGATGAACACACACA

TACTTATATCAAATACAAATTTTTAAAAATTGACTGTCAGGTCAAATAAATGTGAAATTAAACAAAATTCTTCTAAAAAGCAGCTTCCATGAAAAATGGG

GATTCAGTATGCACACATTAAATGCATATATTTCAAACCATACTGAATTTAGGTGGATAAGGGCTAGAAATTTTGAGCAACTAAATTTATCACTTGACCA

AATTTTACCATAAAGAATTATATTCTCTTTTTCTCCTTTGCTGTTGAAGTAACTTACCTGTTGTGTGGATTCTGTATTCTGTACACTCTTGGTTCATGAG

GTTATTTAGCACAAAGTGTAACAGCTTCACCTGGGAAGCTGCTTTTGCTCTATGATGTCCATGGTTTCCCTTCTTTTCTTCAATAAAAACATTTAATGTC

ATTCTGCTCTGTGCC
Translation
MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI - UNI23895 - ISLVEEEDQHLKLCLGSEMGLSSHLQSCKAGSTRIFTSNSHSSVVLQ - UNI

20187 - GFDQLRLDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKAMFTG GGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNMDTLQDTLEA

ASFLQILPVLDFCKVFLISG - UNI7432 - VTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLAFVLSSNSLKRCTELDL

FKATCRWLRLEEPRMDVAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTRLVTLGGVLRQQLVVSK

ELRMYDEKTHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWIQVASLNEKRTFFHLSALKGFLYAVGGRNAAGELP 

- UNI8116 - PTVECYNPRTNEWTYVAKMNEPHYGHAGTVYGGVMYISG GGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDRLYVIG

GNHFRGTSDYDDVLSCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKNEWHKVFDLPESLGGIRACTLTVYPPEE

ATPSPSRESPLSGP
Transcript ENSMUST00000115319
Sequence
ATGCTGAGGTTTATATCCCATTTGTACTGTTGCAGCTCAAAAGAAGAATGTTCAGAGGATGACAAATGTATTCTGAGTAG - UNI23895 - ATCACT

TGTGGAAGAGGAAGACCAGCACTTGAAACTGTGCCTTGGAAGTGAAATGGGCCTCTCTTCCCATTTGCAGTCTTGCAAGGCAGGAAGTACACGCATCTTT

ACCAGCAACAGCCACAGTTCTGTGGTGTTACAG - UNI20187 - GGCTTTGACCAGCTTCGGCTTGATGGATTGCTTTGTGATGTGACACTGATGCC

AGGTGATACAGATGATGCTTACCCTGTGCACAGAGTCATGATGGCATCTGCTAGTGACTACTTCAAAGCTATGTTCACAG GTGGAATGAAAGAACAAGA

GCTGATGTGCATTAAGCTTCATGGCGTGAGCAGAGTGGGTCTACGGAAAATTATTGATTTCATCTATACTGCAAAGCTTTCTCTTAACATGGACACCCTT

CAGGATACGCTGGAAGCCGCCAGCTTTCTTCAGATTCTTCCGGTTTTAGACTTCTGCAAAGTGTTTCTCATATCTGGG - UNI7432 - GTCACTTTG

GATAACTGTGTTGAAGTTGGACGGATTGCCAACACCTACCATCTGACAGAAGTGGATAAATATGTCAACAGCTTCGTCTTAAAGAATTTTGCTGCATTGC

TGAGCACTGGGGAGTTCCTGAAGCTTCCCTTCGAGCGCCTTGCCTTTGTCCTGTCCAGCAACAGCCTTAAGCGCTGCACCGAACTTGACCTCTTCAAAGC

TACCTGTCGCTGGCTTCGCCTGGAAGAACCTAGAATGGACGTTGCTGCAAAACTAATGAAGAATATACGATTTCCGCTGATGACACCACAGGAGCTCATT

AATTATGTGCAAACCGTGGATTTCATGAGAACTGACAATACTTGCGTCAATTTGCTTCTGGAAGCCAGCAATTACCAAATGATGCCGTTTATGCAGCCAG

TTATGCAGTCAGACAGGACTGCCATTCGGTCTGACACCACTCGTTTGGTTACACTCGGAGGAGTCCTGAGACAGCAGCTTGTCGTCAGTAAAGAATTGCG

CATGTATGATGAAAAGACCCACGAGTGGAAATCTCTAGCCCCCATGGATGCCCCAAGATACCAGCATGGCATTGCTGTCATCGGAAATTTTCTCTACGTT

GTTGGTGGGCAGAGTAATTATGACACAAAAGGAAAAACCGCCGTCGATACAGTGTTTAGATTTGATCCTCGATACAACAAATGGATCCAAGTTGCATCTT

TAAATGAAAAGCGCACCTTCTTCCACCTAAGTGCCCTCAAAGGATTTCTGTATGCAGTTGGTGGACGAAATGCAGCTGGAGAACTCC - UNI8116 - 

CTACTGTGGAATGTTACAATCCGAGAACAAATGAATGGACCTATGTTGCCAAAATGAATGAACCTCACTATGGCCATGCTGGAACTGTGTATGGAGGAGT

GATGTATATTTCAG GAGGAATTACCCATGACACTTTCCAAAAGGAGCTCATGTGCTTCGACCCTGATACTGACAAATGGACCCAGAAGGCACCGATGAC

CACTGTCCGAGGCCTACACTGCATGTGTACGGTGGGAGATAGGCTCTACGTCATTGGTGGCAACCATTTCCGAGGAACCAGTGATTATGATGATGTCCTG

AGCTGTGAATACTACTCACCTATCCTTGACCAGTGGACCCCAATTGCTTCCATGTTAAGAGGGCAGAGTGATGTTGGGGTCGCTGTCTTTGAGAATAAAA

TCTATGTGGTTGGTGGCTATTCATGGAATAATCGCTGTATGGTAGAGATAGTGCAGAAGTATGATCCAGAGAAAAATGAATGGCATAAGGTTTTCGATCT

GCCAGAGTCTCTTGGTGGTATTCGAGCTTGTACACTTACAGTTTATCCACCTGAAGAAGCCACACCATCACCTTCTAGAGAGTCCCCTCTTTCTGGACCC

TAAGATCATCCTTACAATTAAGATGCTATATTCCTATCTTTGCAATGTGTCATGATTATCTTCTTTTCCCCCCTTAAGTAGCATATATGTTAGAGTTAGC

CTTCAGTAATTGATACAGAAAAAAAATTGACATTGATGTTACTTGTGATGTTTGTATGGCCTAGAATGTTTATAAAGTGGTAACAAACCATCCTTGAAAT

ATATCCCATAGAAGCTGATGTTTAACATGAAAACAAAAAAAGTATTGTCTACAAAGTGTTTCTTCAGTACTTTCTAAATGCTGTGTACTGAGTGTAAGGG

ATTCCTCATCTTACATTATAAGCCAAGTTGAAGGTGGATTATAGTAAATGTACAACTGTGCTCACTAGGTTTCAAAGTGAAGAAGTTTTCCTTTCATCTT

TAACTGTAAGATGTCAAAGGGAGGCAGCCTGCTCCAATAGGAAACAGTACACAAAAGGTTGCCAACTCGCATGAGCTACCTCCCTCTTTTCATAAAGTAT

TTTTGACACATCTGTCAACCCACCTGACTGTGTGGGTGCATTGAGAACACACCAAGTTTCTAAGACACACAGGAGAAATAACTGAAATTCACCAACACTA

GTTTGTGGGGGAAAGCATGACCCCTCTGCTTATAAGAATTGGTTTGGGGTTTTTTTTAAGTGTGTATAGATGAACACACACATACTTATATCAAATACAA

ATTTTTAAAAATTGACTGTCAGGTCAAATAAATGTGAAATTAAACAAAATTCTTCTAAAAAGCAGCTTCCATGAAAAATGGGGATTCAGTATGCACACAT

TAAATGCATATATTTCAAACCATACTGAATTTAGGTGGATAAGGGCTAGAAATTTTGAGCAACTAAATTTATCACTTGACCAAATTTTACCATAAAGAAT

TATATTCTCTTTTTCTCCTTTGCTGTTGAAGTAACTTACCTGTTGTGTGGATTCTGTATTCTGTACACTCTTGGTTCATGAGGTTATTTAGCACAAAGTG

TAACAGCTTCACCTGGGAAGCTGCTTTTGCTCTATGATGTCCATGGTTTCCCTTCTTTTCTTCAATAAAAACATTTAATGTCATTCTGCTCTGTGCC
Translation
MLRFISHLYCCSSKEECSEDDKCILSR - UNI23895 - RSLVEEEDQHLKLCLGSEMGLSSHLQSCKAGSTRIFTSNSHSSVVLQ - UNI20187 

- GFDQLRLDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKAMFTG GGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNMDTLQDTLEAASFLQI

LPVLDFCKVFLISG - UNI7432 - VTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLAFVLSSNSLKRCTELDLFKATCR

WLRLEEPRMDVAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTRLVTLGGVLRQQLVVSKELRMYD

EKTHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWIQVASLNEKRTFFHLSALKGFLYAVGGRNAAGELP - UNI8

116 - PTVECYNPRTNEWTYVAKMNEPHYGHAGTVYGGVMYISG GGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDRLYVIGGNHFRG

TSDYDDVLSCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKNEWHKVFDLPESLGGIRACTLTVYPPEEATPSPS

RESPLSGP
Transcript ENSMUST00000035973
Sequence
GAATAGGTCTGCTCAACCCTGAGAAGTGATGGATATTCTTCACAGAGGAGAATTGGTTGCTGCAATACTCCGCAACCG - UNI2401 - - UNI1214

9 - - UNI23895 - ATCACTTGTGGAAGAGGAAGACCAGCACTTGAAACTGTGCCTTGGAAGTGAAATGGGCCTCTCTTCCCATTTGCAGTCTTGCA

AGGCAGGAAGTACACGCATCTTTACCAGCAACAGCCACAGTTCTGTGGTGTTACAG - UNI20187 - GGCTTTGACCAGCTTCGGCTTGATGGATTG

CTTTGTGATGTGACACTGATGCCAGGTGATACAGATGATGCTTACCCTGTGCACAGAGTCATGATGGCATCTGCTAGTGACTACTTCAAAGCTATGTTCA

CAG GTGGAATGAAAGAACAAGAGCTGATGTGCATTAAGCTTCATGGCGTGAGCAGAGTGGGTCTACGGAAAATTATTGATTTCATCTATACTGCAAAGC

TTTCTCTTAACATGGACACCCTTCAGGATACGCTGGAAGCCGCCAGCTTTCTTCAGATTCTTCCGGTTTTAGACTTCTGCAAAGTGTTTCTCATATCTGG

G - UNI7432 - GTCACTTTGGATAACTGTGTTGAAGTTGGACGGATTGCCAACACCTACCATCTGACAGAAGTGGATAAATATGTCAACAGCTTCGT

CTTAAAGAATTTTGCTGCATTGCTGAGCACTGGGGAGTTCCTGAAGCTTCCCTTCGAGCGCCTTGCCTTTGTCCTGTCCAGCAACAGCCTTAAGCGCTGC

ACCGAACTTGACCTCTTCAAAGCTACCTGTCGCTGGCTTCGCCTGGAAGAACCTAGAATGGACGTTGCTGCAAAACTAATGAAGAATATACGATTTCCGC

TGATGACACCACAGGAGCTCATTAATTATGTGCAAACCGTGGATTTCATGAGAACTGACAATACTTGCGTCAATTTGCTTCTGGAAGCCAGCAATTACCA

AATGATGCCGTTTATGCAGCCAGTTATGCAGTCAGACAGGACTGCCATTCGGTCTGACACCACTCGTTTGGTTACACTCGGAGGAGTCCTGAGACAGCAG

CTTGTCGTCAGTAAAGAATTGCGCATGTATGATGAAAAGACCCACGAGTGGAAATCTCTAGCCCCCATGGATGCCCCAAGATACCAGCATGGCATTGCTG

TCATCGGAAATTTTCTCTACGTTGTTGGTGGGCAGAGTAATTATGACACAAAAGGAAAAACCGCCGTCGATACAGTGTTTAGATTTGATCCTCGATACAA

CAAATGGATCCAAGTTGCATCTTTAAATGAAAAGCGCACCTTCTTCCACCTAAGTGCCCTCAAAGGATTTCTGTATGCAGTTGGTGGACGAAATGCAGCT

GGAGAACTCC - UNI8116 - CTACTGTGGAATGTTACAATCCGAGAACAAATGAATGGACCTATGTTGCCAAAATGAATGAACCTCACTATGGCCAT

GCTGGAACTGTGTATGGAGGAGTGATGTATATTTCAG GAGGAATTACCCATGACACTTTCCAAAAGGAGCTCATGTGCTTCGACCCTGATACTGACAAA

TGGACCCAGAAGGCACCGATGACCACTGTCCGAGGCCTACACTGCATGTGTACGGTGGGAGATAGGCTCTACGTCATTGGTGGCAACCATTTCCGAGGAA

CCAGTGATTATGATGATGTCCTGAGCTGTGAATACTACTCACCTATCCTTGACCAGTGGACCCCAATTGCTTCCATGTTAAGAGGGCAGAGTGATGTTGG

GGTCGCTGTCTTTGAGAATAAAATCTATGTGGTTGGTGGCTATTCATGGAATAATCGCTGTATGGTAGAGATAGTGCAGAAGTATGATCCAGAGAAAAAT

GAATGGCATAAGGTTTTCGATCTGCCAGAGTCTCTTGGTGGTATTCGAGCTTGTACACTTACAGTTTATCCACCTGAAGAAGCCACACCATCACCTTCTA

GAGAGTCCCCTCTTTCTGGACCCTAAGATCATCCTTACAATTAAGATGCTATATTCCTATCTTTGCAATGTGTCATGATTATCTTCTTTTCCCCCCTTAA

GTAGCATATATGTTAGAGTTAGCCTTCAGTAATTGATACAGAAAAAAAATTGACATTGATGTTACTTGTGATGTTTGTATGGCCTAGAATGTTTATAAAG

TGGTAACAAACCATCCTTGAAATATATCCCATAGAAGCTGATGTTTAACATGAAAACAAAAAAAGTATTGTCTACAAAGTGTTTCTTCAGTACTTTCTAA

ATGCTGTGTACTGAGTGTAAGGGATTCCTCATCTTACATTATAAGCCAAGTTGAAGGTGGATTATAGTAAATGTACAACTGTGCTCACTAGGTTTCAAAG

TGAAGAAGTTTTCCTTTCATCTTTAACTGTAAGATGTCAAAGGGAGGCAGCCTGCTCCAATAGGAAACAGTACACAAAAGGTTGCCAACTCGCATGAGCT

ACCTCCCTCTTTTCATAAAGTATTTTTGACACATCTGTCAACCCACCTGACTGTGTGGGTGCATTGAGAACACACCAAGTTTCTAAGACACACAGGAGAA

ATAACTGAAATTCACCAACACTAGTTTGTGGGGGAAAGCATGACCCCTCTGCTTATAAGAATTGGTTTGGGGTTTTTTTTAAGTGTGTATAGATGAACAC

ACACATACTTATATCAAATACAAATTTTTAAAAATTGACTGTCAGGTCAAATAAATGTGAAATTAAACAAAATTCTTCTAAAAAGCAGCTTCCATGAAAA

ATGGGGATTCAGTATGCACACATTAAATGCATATATTTCAAACCATACTGAATTTAGGTGGATAAGGGCTAGAAATTTTGAGCAACTAAATTTATCACTT

GACCAAATTTTACCATAAAGAATTATATTCTCTTTTTCTCCTTTGCTGTTGAAGTAACTTACCTGTTGTGTGGATTCTGTATTCTGTACACTCTTGGTTC

ATGAGGTTATTTAGCACAAAGTGTAACAGCTTCACCTGGGAAGCTGCTTTTGCTCTATGATGTCCATGGTTTCCCTTCTTTTCTTCAATAAAAACATTTA

ATGTCATTCTGCTCTGTGCC
Translation
MDILHRGELVAAILRNR - UNI2401 - - UNI12149 - - UNI23895 - RSLVEEEDQHLKLCLGSEMGLSSHLQSCKAGSTRIFTSNSHSSV

VLQ - UNI20187 - GFDQLRLDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKAMFTG GGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNM

DTLQDTLEAASFLQILPVLDFCKVFLISG - UNI7432 - VTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLAFVLSSNS

LKRCTELDLFKATCRWLRLEEPRMDVAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTRLVTLGGV

LRQQLVVSKELRMYDEKTHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWIQVASLNEKRTFFHLSALKGFLYAVGG

RNAAGELP - UNI8116 - PTVECYNPRTNEWTYVAKMNEPHYGHAGTVYGGVMYISG GGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCT

VGDRLYVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKNEWHKVFDLPESLGGIRAC

TLTVYPPEEATPSPSRESPLSGP

For any suggestions or comments, please send an email to unitrap@crg.es