Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036822 (Topors)
Chromosomal location
Chr 4: 40206649 - 40216874 (-)
Description
topoisomerase I binding, arginine/serine-rich Gene [Source:MGI (curated);Acc:Topors-001]
RefSeq_dna
NM_134097 
RefSeq_peptide
NP_598858.2 
UniGene
Mm.251548 Mm.402043 Mm.468766 
MGI
MGI:2146189 
Uniprot/SWISSPROT
Q80Z37 
Uniprot/SPTREMBL
A2AP30 Q05D01 
Human Ortholog
ENSG00000197579 (TOPORS)
Omim 609923 - RETINITIS PIGMENTOSA 31  
UniTrap UNI22386
Vector Insertion
Chr 4: 40215535 - 40216706
Public Clones (sanger) 5SP138B03 (ggtc) 3SP098F02 (ggtc) 3SP138B03 (ggtc) 3SD046C05 (ggtc)
IST13870D8 (tigm) IST11637H9 (tigm) IST12693F2 (tigm) IST14221H6 (tigm)
Private Clones OST298853 (lexicon) OST209253 (lexicon) OST144066 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2554
Vector Insertion
Chr 4: 40210115 - 40215336
Public Clones XS0400 (sanger) DTM034 (baygenomics) RRF532 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042575
Sequence
AGGGCGTGAACGCTCAATTTAGGAATGGGTTCTGGAGTTCCAAGCTGCGAGCCAACAGTCTACCTTCGGCTCGCGGGCCCTGCCATGGTGCGCTCTGGAG

CTCCGCTCTGCTCGGTACCTACCAGGGAGTAAGTCCAGTCCAGGCTTCGGCGACTCATCGGCCTCATG - UNI22386 - GGGTCGCAGCCGCCGCCA

CCGGGGTCTCCGCTGTCTCGCGAGGAGGGTGAAGCGCCCCCTCTGGTGCCTGCCGAGGAGGGGAGGCGCCGAAGCCGCCGGGTACGCCTTCGCGGATCCT

GCCGCCACCGGCCGAGCTTACTGAGCCGGCGGGAGCTGGCTTCCAACGGCCCAGCGGTTCCTGCCACCGCGTCCTCGGAG - UNI2554 - ATAATGG

CCTCAGCTGCTAAGGAATTTAAAATGGACAACTTTTCACCTAAAGCTGGCACTAGCAAATTGCAGCAGACAGTACCAGCTGATGCGTCTCCTGATTCTAA

GTGTCCTATATGCTTGGATAGATTTGATAATGTGTCTTACTTAGATCGTTGCCTACATAAGTTCTGTTTTCGCTGTGTACAAGAGTGGTCCAAAAACAAA

GCCGAATGCCCACTGTGTAAACAGCCCTTTGATTCTATTTTCCATTCAGTGAGGGCTGAAGATGACTTCAAGGAGTATGTCCTGAGGCCTTCCTATAATG

GTTCCTTTACTAACCCTGAGGTTCGAAGGTTTCGCTACCGGACAACTATGACGAGAGAACGGAGCGCCTCTCTTTATTCACCCAGTAGTACTGTAAGTAG

GAGAACAACCACGCCACCAGATAGTGGAGTGCTGTTTGAAGGGTTAGGCATTTCGACAAGACCTAGAGATGTTGACATTCCTCAATTTATGAGACAAATG

GCATTAAGGGGGCCAACTACTACAGATGAGAGATCTTTGCGGAAAATTCAAGAACAAGATATTATTAATTTCAGGCGAACTCTTTATCGTGCTGGTGTTC

GAGTTAGAAGTATTGAAGATGGTGGCCGCTACAGGGATATTTCAGCTGAGTTCTTCCGTAGAAATCCAGCTTGCCTTCACAGATTAGTTCCTTGGTTAAA

GCGTGAACTTACTGTGCTTTTTGGAGCCCATGGTTCGCTAGTCAATATCGTCCAGCACATCATCATGAGTAATGTTACTCGCTATGATTTGGAGAGTCAG

GCATTTGTGTCTGACTTAAGACCATTTTTGCTTAATCGAACTGAGCATTTTATACATGAATTTATCAGTTTTGCTAGATCTCCCTTCAATATGGCAGCTT

TTGACCAGCATGCTAATTATGATTGCCCTCCTTCATCTGAAGAAGGCAGCCGTTCAGATTCTTCAGTCATTACAATATCACCAGATGAGGCTGAAACTCA

AGAGCTAGATATGAATGCATCTACTGTTAGGCAGGCACCGTGGGATGATGAAACTCCTGGACCATCTTATTCAAGTTCAGAGCAAGTGCATGTTGGCGTG

TCTTCCCTTTTAAATTCTTCAGACAGTTCAGATGAAGAGCTTGTCTCTGGAGGAACCACATCTCAGATACAAGGAGTACAGACCAATGACGATGTCAATA

ATGACAGTGATTCATCGTCAGATAATTGTGTCATTGTTGGGTTTGTTAAGCCATTGGCTGAAAGGACCCCGGAACTTGTTGAACTGTCTTCTGATTCTGA

GGAGTTGGGCCCTTATGAGAAAGTGGAGACAGTGAAGACTCAGGAGCAAGAGCAGTCGTACAGTTCAGGTGACAGTGATGTTAGCCGGGCGTCATCTCCA

CGCTCTGTCCTTGGAAAAGATGAACAAATGAGTAAAAGCCATTGTGATTCTGACACAAGAATAAGCTCAAAGAAAGAAGAGAAACGATCTACATCATTGC

CAGCTCCCAGGGACAGCTCATCTACAAGAGGTGACAGGGTATGCTCCCCATATAACCATCGACACAGGAAGGGAGGAAGGTCGAGGAGTTCAGATTCCCG

GTCCCAGAGTAGAAGTGGCCATGACCCGAGGAATCACAGGAAGCACGGGAAGAAAAGACTGAGGAACAAGAGGTCCAGAAGCAGGGAGAGTAGTAGCAGG

CCGAGAGCAAGAAAGGACAAAAAGAGATCCAGAACTAGAGATAGCAGCTGGTCCCGGAGGAGCCAGACACTTTCTCTAAGTAGTGGAAGCACCAGTAGAT

CGAGGTCTCGTAGCAGTGATCATGGCAAAAGAAGATCACGAAGCAGAAATCGAGATCGCTATTATTTAAGAAATAATTATGGAAGCAAATATAAGTGGGA

ATACACTTACTACAGCAGAAACAAGGACAGAGATGGCTATGAATCATCATACAGGAGGAGGACTCTTTCAAGAGCCCATTACTCTAGACAGTCTTCAAGT

CCAGAATTTAGAATTCAGTCTTTTTCTGAAAGAACAAATGCGAGGAAGAAGAATCACAGTGAAAGGAAATACTACTACTATGAAAGGCGCCGGTCCAGGA

GCGTGTCCAGTAACAGGTCGAGGACTACATCCGCCGGGCCCGACCGGGTGAGAAATGAGAAGCCCGGAGGGAAACGCAAGTACAAAACCCGGCATTTGGA

AGGTACCAGTGAAGAGGCTCAGCCGGCTCGGGAGTTCACTTCCAAAGGGAAGGACAGTCATTACCAAAAATCAAAATTGGATGGCAGTTATAAAAATGAG

AGTGACAGCTTTTCAGATAGCAGATCATCAGACAGAGAGACAAAACACAAGAGGAGGAGGAGGAGGACCCGGAGCCTAAGTGTAGAGATAGTTTATGAAG

GAAAGGCTACGGACACAAGCAAACACCATAAGAAGAAAAAGAAGAAACATAAGAAGAAGCATAAGAAACACCATGGAGATAATACTTCACGGTCGCCGGT

GGTTATAACCATCGACAGTGACAGCGATGGAGAGTCTGAAGTAAAGGCGGGTATTGAATGTAGCAATGGCAGTCTTCCACAGCCTATACAAGATGGAGCA

TTTGAAACTAAAGATGTTGTCACAATCGAAGATGAGCTTGGTGTCCTGGACAAGGACTGTGACGTTACAGCACTTGCTGATGACTTGAGCACCAGCCAAA

CTGTGGAGAATTGTGACTCGCCGGCAGTCCCAGTTGAACAAACTCTTGATGTAAGAGAAGAAAGCACCTTTGCCTCTGATTTGGAGAGCCAGTCGAGTAA

TGTGTCTATTCAGGCTGAACCATCGAGACCAGTGCCATCTCCACGGACCTCACTGTCATCAGTGTCTCCTGGTAGAGACTGTGATGTGTCTTAAGACTGC

CAGAGCCCCTCCTCGATAATCCGAGGCTGTGGGGAAAAGGTAAAGAGTCATCTATTGCAGTCTAGATGACTTCCTGGAAAAACTTTGCCTCTTAAAATAT

CTTAACTGTGTGTGTTAATTTGTAAAATTCATTATTTGTTCAAAAAGTTATGTATGTCCCATTCCCAGATATATGCACTTTTAAGTGAAGAAAATGTTGC

TAGCTGTTTATTTAAAACTTGGGAAACTTTTTAAATAAAAATCAAAAAAATTTAGAAGTTATTTCATAAAGCCATATGGTATTGACATATTTTTATGGTA

GTATTTTTGAATTTTTTTTTTGAGAGTTATTCTGGAAGTGTGTTACAAGCTAGGAGAATGCTTTTGGACAGTTATTTTTCATAAAAGATTTGTATGATTC

AAAACCATTTCTTAGACTGAAGTAAGTCGTTTTAATCTGCACAGGTTATCTTGGCTTCTGCCAAAAGCAAAGTTTAGTATTTTCTTTATATACTTGGTTA

TCTGGACTGGCAATAAGACAAATGTGTATTCAACAAAAGACAATAAAACTGTACACTCT
Translation
M - UNI22386 - GSQPPPPGSPLSREEGEAPPLVPAEEGRRRSRRVRLRGSCRHRPSLLSRRELASNGPAVPATASSE - UNI2554 - IMASAA

KEFKMDNFSPKAGTSKLQQTVPADASPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFT

NPEVRRFRYRTTMTRERSASLYSPSSTVSRRTTTPPDSGVLFEGLGISTRPRDVDIPQFMRQMALRGPTTTDERSLRKIQEQDIINFRRTLYRAGVRVRS

IEDGGRYRDISAEFFRRNPACLHRLVPWLKRELTVLFGAHGSLVNIVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQH

ANYDCPPSSEEGSRSDSSVITISPDEAETQELDMNASTVRQAPWDDETPGPSYSSSEQVHVGVSSLLNSSDSSDEELVSGGTTSQIQGVQTNDDVNNDSD

SSSDNCVIVGFVKPLAERTPELVELSSDSEELGPYEKVETVKTQEQEQSYSSGDSDVSRASSPRSVLGKDEQMSKSHCDSDTRISSKKEEKRSTSLPAPR

DSSSTRGDRVCSPYNHRHRKGGRSRSSDSRSQSRSGHDPRNHRKHGKKRLRNKRSRSRESSSRPRARKDKKRSRTRDSSWSRRSQTLSLSSGSTSRSRSR

SSDHGKRRSRSRNRDRYYLRNNYGSKYKWEYTYYSRNKDRDGYESSYRRRTLSRAHYSRQSSSPEFRIQSFSERTNARKKNHSERKYYYYERRRSRSVSS

NRSRTTSAGPDRVRNEKPGGKRKYKTRHLEGTSEEAQPAREFTSKGKDSHYQKSKLDGSYKNESDSFSDSRSSDRETKHKRRRRRTRSLSVEIVYEGKAT

DTSKHHKKKKKKHKKKHKKHHGDNTSRSPVVITIDSDSDGESEVKAGIECSNGSLPQPIQDGAFETKDVVTIEDELGVLDKDCDVTALADDLSTSQTVEN

CDSPAVPVEQTLDVREESTFASDLESQSSNVSIQAEPSRPVPSPRTSLSSVSPGRDCDVS

For any suggestions or comments, please send an email to unitrap@crg.es