Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036826 (Tmem149)
Chromosomal location
Chr 7: 31348369 - 31352980 (+)
Description
transmembrane protein 149 Gene [Source:MGI Symbol;Acc:MGI:3655979]
RefSeq_dna
NM_145580 
RefSeq_peptide
NP_663555.2 
UniGene
Mm.333757 
MGI
MGI:3655979 
Uniprot/SWISSPROT
Q3U4N7 
Human Ortholog
ENSG00000126246 (TMEM149)
Omim not available
UniTrap UNI33538
Vector Insertion
Chr 7: 31351956 - 31352161
Public Clones IST14466G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043850
Sequence
AGAGGAACTTGGAGCCAGCTTGGGGTCTGGGTCTGCACTG AAACAGTGTGGGTGGAAGTGGTCACAGCCCTCAAGCTGCAGGCTCTGCTGAGATGGGGC

CCAGCTGGCTTCTCTGGACAGTGGCGGTGGCAGTGCTGCTCCTGACCCGGGCTGCGTCAATGGAAGCCTCTAGCTTCTGTGGCCACCTTGAGTACTGGAA

CTCTGACAAGAGGTGCTGCAGCCGCTGCCTGCAACGCTTTGGGCCTCCTGCATGTCCTG ATCACGAGTTCACGGAAAACTGCGGGCTCAATGACTTCGG

CGATACTGTAGCACATCCTTTCAAAAAGTGTTCCCCTGGGTATTGCAACCCCAATGGCACAGAGCTGTGTAGCCAGTGTAGCAGCGGAGCCGCCGCAGCC

CCAGCTCACGTGGAGAGCCCTGGTAGAACCCACAAGCAGTGTAGAAAG - UNI33538 - AAGCCCGTCCCTCCCAAGGATGTCTGTCCTCTTAAACC

TGAAGACGCAGGTGCCTCTAGCTCACCTGGGAGGTGGAGCCTTGGGCAGACAACCAAGAATGAGGTCTCCAGCCGACCAGGTTTTGTCTCAGCCTCAGTG

CTGCCTCTGGCAGTGTTGCCACTGTTGCTGGTGCTGCTTCTGATATTGGCAGTGGTCTTGCTCTCTTTGTTCAAGAGAAAAGTCCGTTCCCGTCCTGGTT

CCAGCTCAGCTTTTGGAGATCCCAGCACCTCTCTACATTACTGGCCCTGCCCAGGTACCCTGGAGGTATTGGAAAGTAGAAACAGAGGGAAAGCTAATCT

GCTGCAGCTCTCAAGCTGGG AGCTTCAGGGTCTGGCCTCTCAGCCCCTCTCCCTCCTGCTGGATGAGCTGGAAGTTCTGGAGGAGCTGATTATGCTATT

GGACCCTGAGCCTGGGCCGAGCGGGAGCACGGCTTATGGTACCACACGACACCTGGCTGCAAGATACGGGCTGCCTGCCACCTGGTCTACCTTCGCCTAC

TCACTTCGGCCCAGTCGCTCACCCCTGCGGGCCCTGATTGAGATGGTTGTGGCAAGGGAGCCTTCTGCTACTCTGGGTCAATTCGGCACATATTTGGCTC

AGCTAGGTCGCACAGATGCTCTGCAGGTGCTATCTAAACTTGGCTGAGTCAGAGTTTGCTGGGGCTTACTACTCCATCAATAAAGTTTCCCTTGAAGCCA

GT
Translation
 MGPSWLLWTVAVAVLLLTRAASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPD DHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSS

GAAAAPAHVESPGRTHKQCRK - UNI33538 - KPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSASVLPLAVLPLLLVLLLILAVV

LLSLFKRKVRSRPGSSSAFGDPSTSLHYWPCPGTLEVLESRNRGKANLLQLSSWE ELQGLASQPLSLLLDELEVLEELIMLLDPEPGPSGSTAYGTTRH

LAARYGLPATWSTFAYSLRPSRSPLRALIEMVVAREPSATLGQFGTYLAQLGRTDALQVLSKLG
Transcript ENSMUST00000108161
Sequence
GTAAAAATGGCTGAATATTTAGCTTCGATATTCGGGACTGAGAAGGACAA GGTTAACTGCTCTTTTTACTTTAAGATTGGAGCCTGCCGGCACGGGGAC

CGGTGCTCCCGACTTCACAACAAACCGACTTTCAGCCAG ACCATAGTCCTGCTCAACTTGTACCGGAATCCACAGAACACAGCCCAAACTGCAGATGGA

TCACACT GTCACGTGAGCGACGTGGAGGTGCAAGAACACTATGATAACTTCTTTGAG GAGGTATTCACAGAACTGCAGGAGAAGTATGGAGAGATTGA

AGAGATGAATGTGTGTGACAACCTCGGGGACCACCTCGTGGGCAATGTCTACGTTAAGGTGCCTGTTGCCCCCTGCTTAGAACCCAGAAGTGGAAACATT

TCAGTGCCTATGGCCACCACTGAAACCTCCCAACCTGAGGACTATCGATAA TTCCGGCGGGAGGAGGATGCAGAGCGGGCTGTAGCGGAACTCAATAAC

CGCTGGTTCAACGGGCAGGCTGTGCATGCCGAGCTGTCTCCTGTCACTGACTTCCGAGAGTCCTGCTGCCGGCAGTATGAGATGGG GGAATGCACCCGA

GGTGGCTTCTGCAACTTTATGCACCTACGGCCCATATCTCGGAACTTGCGCCGGCAGCTCTATGGGCGAGGACCCAGGCATAG GTCACCTCCAAGGTCC

CACACAGGTCACCGTCCCCGAGAAAGGAACCGACGTCGTTCCCCAGACCACCGGCATGGTCGCTTCTGAGACGGGTGCCCTTGCTCTCCACCCAAGGGCA

TAGATGTTCCTGTCCAGCGTCCCTTTTCAAAGTGCCCTTCACTCTCCAGTCCCAGCATCCCCAGGCTTCGGAGCTTCATAATATAATCTGTTCGACACAG

GAACCTCCTCCTCCTGTCCCTCCTCCAATAAAGGTTAAGAAGTTTGTCAATCAAGGTCTGTGGTTTCCTTCCACCCCCACACCTAAGAAAGGGTGTAAGC

CAACCACAGTCTCAGCAGAGGAACTTGGAGCCAGCTTGGGGTCTGGGTCTGCACTGGTAAGTCGGGGCTGCTTTAATACCTGTAACCTCAGATTATCCAT

TCTAGGTGCCTTTTAGGGACAGGTGCCTGTTTGTGACAGGCCAGAGGATTCCAAACAGAGATGGAAGTTAGAAAAGGAGAGGTGCTTAGGTACTGGTGAG

AGTTTACAGTAGGTTAGGCCTGGTAATTGAAACCCACCATACCACCCCGAAATGAAGGCACTACATAATTCCTAACACTTATAAAACTTTGAACTAAGTT

TACTCTCTGCTAGGTACTGTGGTGTCTGGCTTGTTTGTTTTGTTTCTGAAGCAGAGTTTCACTCGCTCTGGGTGGCCTGGTACTTGTTATGTAGCCCATG

TTGGCCTCAGGTTTCCAAGAGATGCTCCTGCCTGTACTTGAAGTGCTGAGATTGAAGTGTACACACTACGCCTATTGTGATCTTTTAAGTAGATTTATTA

TCTCTCTCTCTCACACACACACACACCGCCTTCACCCAGTGAGACAAGTTCTATTACCCCATCTTAGAGATGAAAATGAGAAGGCAGGTATGTAAGGTTA

CAAATAATCTGGTGATCCACATCAAGTTCTTTATACGCCTTGTGGGCTTGGAGTTGGGTATGAGACACGCCAGCTCCCAAAGAGGTTCTGGAAGTCTGTG

ACCCCCACATCCACCGCTTTCTTCTGCCTTGGACTTCCTGGAATGTGCTGCAGAAACAGTGTGGGTGGAAGTGGTCACAGCCCTCAAGCTGCAGGCTCTG

CTGAGATGGGGCCCAGCTGGCTTCTCTGGACAGTGGCGGTGGCAGTGCTGCTCCTGACCCGGGCTGCGTCAATGGAAGCCTCTAGCTTCTGTGGCCACCT

TGAGTACTGGAACTCTGACAAGAGGTGCTGCAGCCGCTGCCTGCAACGCTTTGGGCCTCCTGCATGTCCTG ATCACGAGTTCACGGAAAACTGCGGGCT

CAATGACTTCGGCGATACTGTAGCACATCCTTTCAAAAAGTGTTCCCCTGGGTATTGCAACCCCAATGGCACAGAGCTGTGTAGCCAGTGTAGCAGCGGA

GCCGCCGCAGCCCCAGCTCACGTGGAGAGCCCTGGTAGAACCCACAAGCAGTGTAGAAAG - UNI33538 - AAGCCCGTCCCTCCCAAGGATGTCTG

TCCTCTTAAACCTGAAGACGCAGGTGCCTCTAGCTCACCTGGGAGGTGGAGCCTTGGGCAGACAACCAAGAATGAGGTCTCCAGCCGACCAGGTTTTGTC

TCAGCCTCAGTGCTGCCTCTGGCAGTGTTGCCACTGTTGCTGGTGCTGCTTCTGATATTGGCAGTGGTCTTGCTCTCTTTGTTCAAGAGAAAAGTCCGTT

CCCGTCCTGGTTCCAGCTCAGCTTTTGGAGATCCCAGCACCTCTCTACATTACTGGCCCTGCCCAGGTACCCTGGAGGTATTGGAAAGTAGAAACAGAGG

GAAAGCTAATCTGCTGCAGCTCTCAAGCTGGG AGCTTCAGGGTCTGGCCTCTCAGCCCCTCTCCCTCCTGCTGGATGAGCTGGAAGTTCTGGAGGAGCT

GATTATGCTATTGGACCCTGAGCCTGGGCCGAGCGGGAGCACGGCTTATGGTACCACACGACACCTGGCTGCAAGATACGGGCTGCCTGCCACCTGGTCT

ACCTTCGCCTACTCACTTCGGCCCAGTCGCTCACCCCTGCGGGCCCTGATTGAGATGGTTGTGGCAAGGGAGCCTTCTGCTACTCTGGGTCAATTCGGCA

CATATTTGGCTCAGCTAGGTCGCACAGATGCTCTGCAGGTGCTATCTAAACTTGGCTGAGTCAGAGTTTGCTGGGGCTTACTACTCCATCAATAAAGTTT

CCCTTGAAGCC
Translation
       MGPSWLLWTVAVAVLLLTRAASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPD DHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTEL

CSQCSSGAAAAPAHVESPGRTHKQCRK - UNI33538 - KPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSASVLPLAVLPLLLVLL

LILAVVLLSLFKRKVRSRPGSSSAFGDPSTSLHYWPCPGTLEVLESRNRGKANLLQLSSWE ELQGLASQPLSLLLDELEVLEELIMLLDPEPGPSGSTA

YGTTRHLAARYGLPATWSTFAYSLRPSRSPLRALIEMVVAREPSATLGQFGTYLAQLGRTDALQVLSKLG

For any suggestions or comments, please send an email to unitrap@crg.es