Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036863 (Syde2)
Chromosomal location
Chr 3: 145651617 - 145684007 (+)
Description
synapse defective 1, Rho GTPase, homolog 2 (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:3036264]
UniGene
Mm.268854 
MGI
MGI:3036264 
Uniprot/SPTREMBL
Q8BKW6 
Human Ortholog
ENSG00000097096 (SYDE2)
Omim not available
UniTrap UNI32626
Vector Insertion
Chr 3: 145652134 - 145661429
Public Clones IST14797A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34173
Vector Insertion
Chr 3: 145662075 - 145664286
Public Clones IST14515H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38661
Vector Insertion
Chr 3: 145670107 - 145677221
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039517
Sequence
AGTCCTCGGATACAACTGTCCAGTTGCAGAAGTCTCGAGAGCCTCCGCGTGAGCCGGCGGCCGCCTCTGCTCCAGCGGTGGGCGAGCGACAGCTGCATCA

GGTGCGGTGCGCACCGGGACAGGGACGAGCCCCAGCCACGTGGAGGTGGGATGGACGGCTGGAGCCCGGGCAGCCACAGGGCTGCTACGTCCGCCGCTCT

CCTGCCTCCCATCTGCCATGACCCCAGCGGGTCCTCGGGACGACCCTTTAAGGATCCTGTGGGGACCTCTGTGATATCCAGCAGCCAAGAGGACCATCCG

GAGGATCTTCCCCTCAAGCCACCTGCGGTGACTGTCAAGAAACTGCAGAAGTGGATGTACAAAGGACGTCTGCTGTCCCTGGGGATGAAGGGTCGCGATC

GCGGGACAGCACCCAAAGTTCCCGGAGCGCAGACAACCTCTCCAAATTTGGGCAGTTGGAAAGTGCATGAAAACCACGTCCTCTCGGTGACAACGGACCA

AAGAATCACACTGACAG - UNI32626 - ACTTATTTGAGAATGTCTATGGCTCTCCACTGAAGAAACGAGAACCTGAAGATGTAAGGGGTCCCGCCG

AGCTTAGAGGTCACCAGCCCCTTAACAACATCACAGTTTCAAAGAAGCGCAATTGGCTGTATCAGAGCACCCTGAGGTCTCAGAGTCTGGACGAGAGCAA

GCGAAGCCAGGACAGACGCTATTTCTCCCTCTCTCCTGTGTCTCCACCCAAGCATTGGGTATCCCACAGGCCGCACTGCACACATGCGGTGTGTAATGCT

GCCAGGGCTACGTTGTCCAGAAACGGCTCTTCAGCCTTTAGCGAGGACAATGATGCGGACGATGAAGGAGAAATATGGTACAATCCCATCCCTGAGGATG

ACAGCTTGGGCATAGCACACGTCTTGAGTCTTGAGGAGGCAAACACCGCCGCCCTGAAGCTTCCTGTGAGCATGTTGTCTGCCAGAGATCTGATGAAGGC

GGAGCCTCCTAGTGAAGACAGAGGGGACGTGCAGACCTCACAGTCAAATGGAATTAATTCTGCAGATTCCATGCATTCTACAGAAATTATGCAGCACTGC

AAACAAAGGTTAGGGCACAGGACACAAGAAAGCCCGACGGCAGAGGATAGCCCTGTGTTGAAATCTGCTTCTACAG - UNI34173 - GTCCCGGGAT

CATAGTCTCTACAAATAGGACTGAACTGAGAGCGATGGAGCCGTCTTCTCCAAGCCCCAGTCCTGGGAAGAAAGGCAGTTCCATTACTTGGTCTTTACCA

GATAAAATAAAGTCTCCACGCACTGTGAGGAAACTTTCTATGAAAATGAAAAGGTTGCCAGAATTCAGCCGAAAGCTGGGGGCCAGGGGAGCTTTGCACT

ATGTGAATAATCCGGATAGCACCCCTCCTTTGTCTAAATGGAACTGTCGAGAAATTCCTCAGGGTGTCACTCTGACTTCCGGGAACACCACCAGGAACGT

GATAAGCCGGTACCATCTTGATACCACCGTATCCTCTCGGCACAGCTACCGGAAGAAACCCCTTGGGAGCTCGAAGTATTCCTGCAAGGGTGGGTACCTC

AGCGACGGAGACTCACCCGAACTGAGAACTAGATCTAGCAAGCATGGATCGGAGCACAAACTTGGGAAAGGGAGAGAAACTGTCCCAAGCAGTTGTAGCA

AAAATGAACTAGACATCGGTGCCTTCAGACATTACAGCTTTGCGGATCAACCCAAATGCTCGCAGTACATATCCGGCCTCATGAGCGTACACTTCTATGG

AGCTGAGGGTTTAAAACCGCCCCGGATAGATTCGAAAGATGTGTTTTGTGCCATTCAGGTAGACTCAGTGAACAAAGCCAGAACGGCCCTGCTCACCTGT

CGGACGACCTTCTTAGACATGGACCACACGTTCAACATAGAGATTGAAAATGCGCAGCATCTGAAGCTGGTGGTGTTCAGCTGGGAGCCCACGCCGAGGA

GGAACCGCGTGTGCTGTCATGGCACAGTCGTCCTGCCCGCTTTATTCAGAGTTACAAAAACGCATCAGCTGGCTGTCAAGCTGGAGCCCAGAGGCCTTAT

TTACGTCAAGGTGACCCTGATGGAACAGTGGGAGAATTCTCTGCACGGCCTGGATAAGAACCGCGAAGCGGTGATGTTCGGAGTCGACATTCAAAAAGTT

GTAGAGAAAGAAAACGTAGGCTTGATGGTGCCGCTGCTGATACAGAAATGCATCGTGGAGATTGAAAAGAGGGGTTGTCAG GTTGTAGGCCTGTATCGA

TTGTGTGGTTCAGCGGCGGTGAAGAAAGAGCTTCGAGAGGCTTTTGAGAAGGACAGCAAGACTGTTGGTCTGTGTGAAAACCAGTACCCAGATATAAATG

TAATAACAG GGGTTCTTAAGGACTACTTGAGAGAACTCCCTTCTCCCCTAATAACCAAGCAGCTGTATGAGGCTGTGTTGGATGCCATGGCGAAGAGTC

CTTTGAAAATGTCGTCCAGTGGTTGTGAGAACGAGCCCAGTGACTCCAGGCTCACTGTGGACCTCCTGGATTGCCTGCCGGACGTTGAGAAG GCAACCC

TGAAGATGTTGTTGGATCATCTGAAACTGGTGGCCTCCTACCACGAAGTGAATAAGATGACCTGCCAGAATTTGGCTGTGTGCTTTGGACCAGTGTTGCT

TAACCAGAGGCAAGAGGCTTCAACCCACAACAACAGAGTCTTCACCGATTCTGAAGAGCTTGCCAGTGCTTTGGATTTTAAAAAACACATCGAGGTTCTT

CATTACTTGCTCCAGCTCTGGCCAG TGCAACGCTTAACTGTCAAAGAACCCAGAGACAGTTTGTGCCTGGAGCAGTCGTCTTCTCTGAATTACTTGAGG

CGAAAGAAAGAGCGGCCGTGTGTGTTAAACCTGAGCGGTCCGGATTCATCAGGGGTGCTGAGGACAAGGCAGGCCCGATTAGACAGTCCACTCAGCAACC

GCTATGCAGGAGACTGGAGCAGCTGTGGGGAGAGCTACTCTTTAAATACAAGAGGAAATGTCAAGAATTTGGACTATGATGACGGCCCCTTAGAAGGTGG

AGAAAGTAGACAGTATAGCAAAACAGCCGGAGCGGAAGTCATGACCGCACAACGAATCCCCATGTCAGGGGGGTGCACGTTTCAGACGTACTTGACGGTA

CAGACCATTGAATCCACGGTGGATCAGAAAGCTAACCTCAGAGATTTGCAAGAGAGCATTGATACTTTGATTGGCAATCTGGAACGTGAGCTCAACAAAA

ACAAGCTGAACATGAGTGTTTGAGATGGACGGCTTGTTTTATTTGTGATGATGTCATCAAGTTTCATGTCAATCCTTTTTCTGGGGAAAAAATATATATA

ACATATTATATATATATATATATATTGGATCCTTAAGTTAATTCTTAATAAGTTCATGTCATTCAATTATAAACACTATTCATTAATATGGTTATTTTAC

TTGTGAACTGAGCTGTTCTGGGCATAAAGGTAACCAGACCTTGGGGGATAGTTTAATAAACCTTGCCAGTTGTATGGAGGAGACATGCAGATGTTTGTAA

GGGTCGGGTACATTATTATCCCGACAAGGCTTCGGCGAGAATGTTCTTCTGTACGTGGAGACGGATGTTCTCTGCAGAGGACACTGCAGCTGGACTGATT

TGCAGTCAGAGTCCCTGTGCAATGTCATTTGGTCATATTTCATTTGCAATATGAATGCTGCTGCTATAAGAAAAATTTTTATAAATGTAAAATTATACAG

GTATTAATGTATTTTGTATTAACATTTCGTAATTATTTAAGCTTATAAAATTAAATATTTTTATGGTTCTGAGAATATATATTTATAACTTAATTATGCA

TATAGGTTTTAGAATGAGGGAAGGGGTTGGTTACAGCATTCCAAATATTTTAAAAATAAGGCCAAAGTTATTAGCTTAAAAATGTCTTTTTCAGGGAAAG

AATGTTTAAGTTAAAAGACAAGTTACATAAGACCACTTGAATAAAAACGCACCAGAACTATTTGAGT
Translation
SPRIQLSSCRSLESLRVSRRPPLLQRWASDSCIRCGAHRDRDEPQPRGGGMDGWSPGSHRAATSAALLPPICHDPSGSSGRPFKDPVGTSVISSSQEDHP

EDLPLKPPAVTVKKLQKWMYKGRLLSLGMKGRDRGTAPKVPGAQTTSPNLGSWKVHENHVLSVTTDQRITLTD - UNI32626 - DLFENVYGSPLKK

REPEDVRGPAELRGHQPLNNITVSKKRNWLYQSTLRSQSLDESKRSQDRRYFSLSPVSPPKHWVSHRPHCTHAVCNAARATLSRNGSSAFSEDNDADDEG

EIWYNPIPEDDSLGIAHVLSLEEANTAALKLPVSMLSARDLMKAEPPSEDRGDVQTSQSNGINSADSMHSTEIMQHCKQRLGHRTQESPTAEDSPVLKSA

STG - UNI34173 - GPGIIVSTNRTELRAMEPSSPSPSPGKKGSSITWSLPDKIKSPRTVRKLSMKMKRLPEFSRKLGARGALHYVNNPDSTPPLSK

WNCREIPQGVTLTSGNTTRNVISRYHLDTTVSSRHSYRKKPLGSSKYSCKGGYLSDGDSPELRTRSSKHGSEHKLGKGRETVPSSCSKNELDIGAFRHYS

FADQPKCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLP

ALFRVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQ VVGLYRLCGSAAVKKELR

EAFEKDSKTVGLCENQYPDINVITG GVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEK ATLKMLLDHLKL

VASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPV VQRLTVKEPRDSLCLEQSSSLNYLRRKKERPCV

LNLSGPDSSGVLRTRQARLDSPLSNRYAGDWSSCGESYSLNTRGNVKNLDYDDGPLEGGESRQYSKTAGAEVMTAQRIPMSGGCTFQTYLTVQTIESTVD

QKANLRDLQESIDTLIGNLERELNKNKLNMSV

For any suggestions or comments, please send an email to unitrap@crg.es