Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036867 (Smad6)
Chromosomal location
Chr 9: 63800953 - 63869866 (-)
Description
MAD homolog 6 (Drosophila) Gene [Source:MGI (curated);Acc:Smad6-001]
RefSeq_dna
NM_008542 
RefSeq_peptide
NP_032568.2 
UniGene
Mm.325757 
MGI
MGI:1336883 
Uniprot/SWISSPROT
O35182 
Uniprot/SPTREMBL
Q80ZV9 
Human Ortholog
ENSG00000137834 (SMAD6)
Omim not available
UniTrap UNI19765
Vector Insertion
Chr 9: 63860079 - 63868011
Public Clones IST13708F3 (tigm)
Private Clones OST381275 (lexicon) OST252599 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25068
Vector Insertion
Chr 9: 63855416 - 63860021
Public Clones not available
Private Clones OST196618 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17237
Vector Insertion
Chr 9: 63801864 - 63855337
Public Clones IST14914C10 (tigm) IST13036D12 (tigm)
Private Clones OST447088 (lexicon) OST393074 (lexicon) OST368616 (lexicon) OST341300 (lexicon)
OST332612 (lexicon) OST280441 (lexicon) OST199499 (lexicon) OST169711 (lexicon)
OST46701 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041029
Sequence
AGACTGGCATATGATGGGAGGCAGCCAATGACTCCGCGGCGCTCCTCCGGGGGCCCTCAGTGTGCGTTTGAGGAGAACAAAAAAGAGAGAGAGCGCCGAG

AGGGGGAACGAGCGAGGGAGCTGAGTCCAGAGAAAGAGCCGCCGGGCGCTGCCTCGCCAAACCTCGCTGGGACCGCGGGGCCACCAGGAGGCACTTTGGT

GAAGGGGGGGGGGGGCGACCTCGGCAGCCGCGGCGCCCGAAGCGACCCAGCGCAGCGTGGGGCGGGCTGCGACCTCTGCTTCGGTGGATTGCATTTTTAA

TTAAGGATTCCTAGCAGCTCTTTGGGATTTTTTTTTTCCGGCTTCCACTCATGTGTTGACACCCGCGTTCAGGAGAGACTTGCCCCAAGTGCACCGAGCG

CCCGGGACCTGAGACGGAATTGCTTTTCGTGCGTGCAAAATCCAAGCATTTTGAGTTTTGTTTGGGACCTTTTTCTTGCTTTGCTTTTATTTCTATTTTT

ATTTTGTTGCAGGGATATGGGAGTTATCCACAAGCCTTAGTTTCGGATCCTGCAGGGAAAGCCCATGTAGCATAGCTTGGCTTTTGAAGGCAGAGTTGTG

CAGACACATTTGGGGGCACGACGCAAGCGCTTTGTGCTCGTGTACCAGCCGCGCAACTTTTGAAGGCTCGCCGGCCCATGCAGGGTGTCTCTAGCATCGT

TTCGCTGGTGGCTTCCCTAAGGCTCCAAAGCAGCTGGAGTTGAGCGGTCCCGGCCCATCGTGATCCATGTAGCCCGCTGGTCCCTCGCGGACTGAGGCTC

AACACGCGCGTGTTCCCGGCCCGGCCCGGCCCGGCTTGGCCCGGCGCGAGCTCCCTCATGTTGCAGCCCTGCGGTGCCCCTTCGACGACAGGCTGTGCGC

GGTCTGCACGGCGCCCCGCGGCAGAGCTTCATGTGGGGCTGCGGCCCGCTCAGCCGGCGCCTCGTTGAGGGAACGGACCCCCGGTAACCGGAGACCGCCT

CCCCTCCCACCACCCCAGGCGCCAAAGGGTATCGTATGTTCAGGTCTAAACGTTCGGGGCTGGTGCGGCGACTTTGGCGAAGTCGTGTGGTCCCTGATCG

GGAGGAAGGCAGCGGCGGCGGCGGTGGTGTCGACGAGGATGGGAGCCTGGGCAGCCGAGCTGAGCCTGCCCCGCGGGCACGAGAGGGCGGAGGCTGCAGC

CGCTCCGAAGTCCGCTCGGTAGCCCCGCGGCGGCCCCGGGACGCGGTGGGACCGCGAGGCGCCGCGATCGCGGGCAGGCGCCGGCGCACAGGGGGCCTCC

CGAGGCCCGTGTCGGAGTCGGGGGCCGGGGCTGGGGGCTCCCCGCTGGATGTGGCGGAGCCTGGAGGCCCAGGCTGGCTGCCTGAGAGTGACTGCGAGAC

GGTGACCTGCTGTCTCTTCTCCGAACGGGACGCAGCAGGCGCGCCCCGGGACTCTGGCGATCCCCAAGCCAGACAGTCCCCGGAGCCGGAGGAGGGCGGC

GGGCCTCGGAGTCGCGAAGCCCGCTCGCGACTGCTGCTTCTGGAGCAGGAGCTCAAGACGGTCACGTACTCGCTGCTCAAGAGGCTCAAGGAGCGTTCGC

TGGACACGCTGTTGGAGGCTGTGGAGTCCCGAGGCGGCGTACCGGGCGGCTGCGTGCTGGTGCCGCGCGCCGACCTCCGCTTGGGCGGCCAGCCCGCGCC

ACCGCAGCTGCTGCTCGGCCGCCTCTTCCGCTGGCCAGACCTGCAGCACGCAGTGGAGCTGAAACCCCTGTGCGGCTGCCACAGCTTTACCGCCGCCGCC

GACGGGCCCACGGTGTGTTGCAACCCCTACCACTTCAGCCGGCTCTGCGGGCCAG - UNI19765 - AATCACCGCCGCCCCCCTATTCTCGGCTGTC

TCCTCCTGACCAGTACAAGCCACTGG - UNI25068 - ATCTGTCCGATTCTACATTGTCTTACACTGAAACCGAGGCCACCAACTCCCTCATCACTG

CTCCGGGTGAATTCTCAG - UNI17237 - ATGCCAGCATGTCTCCGGATGCCACCAAGCCGAGCCACTGGTGCAGCGTGGCGTACTGGGAGCACCGG

ACACGCGTGGGCCGCCTCTATGCGGTGTACGACCAGGCTGTCAGCATTTTCTACGACCTACCTCAGGGCAGCGGCTTCTGCCTGGGCCAGCTCAACCTGG

AGCAGCGCAGTGAGTCGGTGCGGCGCACGCGCAGCAAGATCGGTTTTGGCATACTGCTCAGCAAGGAGCCAGACGGCGTGTGGGCCTACAACCGGGGCGA

GCACCCCATCTTCGTCAACTCCCCGACGCTGGATGCGCCCGGAGGCCGCGCCCTGGTCGTGCGCAAGGTGCCACCGGGTTACTCCATCAAGGTGTTCGAC

TTTGAGCGCTCAGGGCTGCTGCAGCACGCAGACGCCGCTCACGGCCCCTACGACCCGCACAGTGTGCGCATCAGCTTCGCCAAGGGCTGGGGACCCTGCT

ACTCGCGACAGTTCATCACCTCCTGCCCCTGTTGGCTGGAGATCCTACTCAACAACCACAGATAGCAATGCGGCTGCCACTGTGCCGCAGCGTCCCCCAA

CCTCTGGGGGGCCAGCGCCCAGAGACACCACCCCAGGGACAACCTCGCCCTCCCCCCAGATATCATCTACCTAGATTTAATATAAAGTTTTATATATTAT

ATGGAAATATATATTATACTTGTAATTATGGAGTCATTTTTACAACGTAATTATTTATATATGGTGCAATGTGTGTATATGGAGAAACAAGAAAGACGCA

CTTTGGCTTGTAATTCTTTCAATACAGATATATTTTTTTCTTTCTTTCCCTCTTTCCTTTTTTAAAGAGAATTATACAGTAGAACTAGGTGGAAAGCCTA

GGTTTGGTGTATGGCTTTTTTAAAAAATATTAATGCCCAGACC
Translation
MFRSKRSGLVRRLWRSRVVPDREEGSGGGGGVDEDGSLGSRAEPAPRAREGGGCSRSEVRSVAPRRPRDAVGPRGAAIAGRRRRTGGLPRPVSESGAGAG

GSPLDVAEPGGPGWLPESDCETVTCCLFSERDAAGAPRDSGDPQARQSPEPEEGGGPRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRG

GVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFTAAADGPTVCCNPYHFSRLCGPE - UNI19765 - ESPPPPYSRLSP

PDQYKPLD - UNI25068 - DLSDSTLSYTETEATNSLITAPGEFSD - UNI17237 - DASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAV

SIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLLQHADAAH

GPYDPHSVRISFAKGWGPCYSRQFITSCPCWLEILLNNHR

For any suggestions or comments, please send an email to unitrap@crg.es