Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036890 (Gtdc1)
Chromosomal location
Chr 2: 44419932 - 44717142 (-)
Description
glycosyltransferase-like domain containing 1 Gene [Source:MGI (curated);Acc:Gtdc1-001]
RefSeq_peptide
NP_766250.1 
MGI
MGI:2444269 
Uniprot/SWISSPROT
Q8BW56 
Uniprot/SPTREMBL
B1AY88 B1AY87 
Human Ortholog
ENSG00000121964 (GTDC1)
Omim not available
UniTrap UNI20115
Vector Insertion
Chr 2: 44715810 - 44715856
Public Clones not available
Private Clones OST372526 (lexicon) OST65687 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24250
Vector Insertion
Chr 2: 44681064 - 44715810
Public Clones IST14252F2 (tigm) IST14256F2 (tigm) IST14048E2 (tigm)
Private Clones OST227014 (lexicon) OST190424 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21797
Vector Insertion
Chr 2: 44447400 - 44447511
Public Clones not available
Private Clones OST317662 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100127
Sequence
ATCTTGCAGGTACAAGATTGGATATCAGTTCATCTGGATCAGAAG - UNI20115 - - UNI24250 - GTTTGAACAGGCCAATGAGTATTGTCAT

CATCGAGGCATTTTATGGAGGCTCCCATCGACAGCTGGTAGAGCTGCTCCGAGAAGAATTAGATGACTGCGTGTTGTACACTCTTCCTGCAAAGAAATGG

CACTGGAGAGCACGCACAGCAGCCTTATACTTCTCACAGAATATTCCCAGCAGTGAGCACTACAG GAGGCGGAGAAGCTGGAACTGCTGCTGTGTGCCT

GACCACAGAACTGGATTTACTTTCTGCTTGACAGTCTCTAAAAACAACACTGAAAAATTCTTCTTAGCACGTGATTGGACTTCAGAACTCAGATCATCTC

TTTTCTGA
Translation
 - UNI20115 - - UNI24250 - MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYR RRRRSWNCCCVP

DHRTGFTFCLTVSKNNTEKFFLARDWTSELRSSLF
Transcript ENSMUST00000112810
Sequence
AAGACAGCAGGCTGAGCAAGCCAGGGGAAGCAAGCCAGTAAAGAACATCCCTCCATGGCCTCTGCATCAGCTCCTGCTTCCTGACCTGCTTGAGTTCCAG

TCCTGACTTCCTTGGTGATGAACAGCAATGTGGAAGT - UNI20115 - GTACAAGATTGGATATCAGTTCATCTGGATCAGAAG - UNI20115 -

 - UNI24250 - GTTTGAACAGGCCAATGAGTATTGTCATCATCGAGGCATTTTATGGAGGCTCCCATCGACAGCTGGTAGAGCTGCTCCGAGAAGAA

TTAGATGACTGCGTGTTGTACACTCTTCCTGCAAAGAAATGGCACTGGAGAGCACGCACAGCAGCCTTATACTTCTCACAGAATATTCCCAGCAGTGAGC

ACTACAG GACCCTCTTTGCAAGCTCAGTACTCAACCTGACTGAACTGGCTGCCCTTCGGCCTGATCTGGGAAAACTGAAAAAGATCTTATACTTCCATG

AAAACCAGTTGGTGTATCCTGTCAAGAAATATCAGGAGAGAGATTTTCAATATGGATACAACCAAATTCTCTCGTG TTTGGTGGCTGATGTTGTGGTAT

TCAATTCCAGTTTTAATATGGAATCATTTCTTACTTCTATTGGAAAATTCCTGAAGCTGATTCCTGATCACAGGCCTAAGGATCTGGAAAGCATTATCAG

ACCCAAGTGTCAAGTTATTTATTTTCCCATCAGATTTCCTGATGTGAGCAG ATTCATGCCCAAGCACAAAATAGCCCACTTAAGGAGGATGCTCAGCCT

TATTGGAGATGCTGCTGCATCTCAGTCTGTGGCGCCTTGTCCCCAGCCAGGGCAGAGGGTTTCTGAGAAGTCACCGGAGAACTGTGAATCAAAGTCTGAT

GAACACCCTGACCTTGATGCTGAACAAGAAGCCCTGGACAACCCATCAGTCCATAAATCAGGCTCTCTTCCTGTGAGTAAAGAAAACCTGCCTCTTGATC

CCAGCACCCTTCTGTGTGGAGCTGAAGATCCGCAAAGACCGCTGCACATTACATGGCCGCACAGGTG - UNI21797 - GGAGCATGACAAAGATCCA

GAGACGTTCTTAAAGATACTAATGAGTCTAAAGCAGTTAAACTTGAACTTCCATGTCTCTGTCCTCGGAGAGACTTTTACAGACACACCAG - UNI217

97 - ATATATTTTCAGAAGCCAAAAAGGCACTGGGCTCTTCAGTCTTGCACTGGGGCTACTTACCCCGTAAAGAAGACTATTTCCGCGTACTGTGCATG

GCTGACGTTGTCATCTCAACAGCCAAGCATGAATTCTTTGGAGTAGCAAT GTTGGAAGCTGTGTACTGTGGCTGCTACCCACTCTGTCCCAAAGCCTTG

GTCTATCCTGAGATCTTTCCAG CTGAGTATCTGTATTCCACACCTGAACAGCTTTCAAAACGGCTCAAGAGTTTCTGCAAGAGGCCAGATATTATAAGA

AAACATCTTTATAAG GGTGAAGTGGCTCCATTTTCTTGGGCAGCCCTACATGGTAAATTCAGGTCTCTGCTCACAACAGAACCCAGGGAAGATTTGTGA

CAGATGGGGCTAAGTCGCAAACTTGCAGCCTAAGGCAGAATCTGAAGAACTTTCCAGAGTGTGCCCATATTTACCTGATCAGAGAGAAAAGAAAATCTGC

AGAGGAAGCCGAGCCTGGCTGCTTGTCATAGCTGACACAGAGCCATCTGCCACAAACCTGTGGCGGCTTCAGATCTCCAATCCCTGCCACCACCCCAACT

CAAATTAAATACAGATTCCTAGAGACGTTATGATGGTTACACATGTCCTCGGCATCACATGTAGGAGACTGTTCAAAAAAAAATCTGTGGCCTGTTGTAT

AACCGCACTCATGTATCCCATATGTGGTGCCACATTGAATTTCCGGTTGAATCCGTTTTTATCCTTTGTACTGGATGACACGGAGCCTGAATTCTTTCTT

TCTGCCGACACGATGGCAGCCAAACTGCAGCTTCAAACACTCACACTTGGCTGAGTTTCTACCTGGGTTGCCAGGTTATCATCGGAGCCTTCTTGTGTCC

TCAAAGGGCCACGGGGCCTAGAAAGAGGATCAGAATGCTACTGAACTAATTGGGCAGCCATCTCAAAGCTGCTGTAGGCAAAGGGCTGCTGTAGCACTTT

TCTTTTAGCAAATTAATGACTCTCTGGCAAAGGAGTGTTTAAGTGAAGGCATTAATAAGGGCTCTGGCAGGTATTCCCATGATTCTCAGAGTTCCATTTG

CATTGAATTAATCTTAAAGAAACTTGCAAGATAAACAGCTGGAATTCGGACAAACATGGCAGATTCAGTGAGTGAAGTCCTCTCATCCATAAAATGAACA

CGAGATACTTGTTTTAAAATTTTTTCCCTGTGGGTAAAAATAGAAAAATCAGAATGCTTATAACAAAACATAATTTGGTACAAAATTCTTCAAAATACTT

GTATCCAACTATAAATATATTCTTCTTGAGATAAGTCACTTACGATTCTTGCTCTGTTTGTTGGTGTAAAGATGTTTTAAATGGCTGGATTGTAAAATAC

ATTTTTAATAAACTGCCCGCTGCAATTTTAATTAGCATA
Translation
 - UNI20115 -  - UNI20115 - - UNI24250 - MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHY

R RTLFASSVLNLTELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSC CLVADVVVFNSSFNMESFLTSIGKFLKLIPDHRPKDLESI

IRPKCQVIYFPIRFPDVSR RFMPKHKIAHLRRMLSLIGDAAASQSVAPCPQPGQRVSEKSPENCESKSDEHPDLDAEQEALDNPSVHKSGSLPVSKENL

PLDPSTLLCGAEDPQRPLHITWPHRW - UNI21797 - WEHDKDPETFLKILMSLKQLNLNFHVSVLGETFTDTPD - UNI21797 - DIFSEAKK

ALGSSVLHWGYLPRKEDYFRVLCMADVVISTAKHEFFGVAM MLEAVYCGCYPLCPKALVYPEIFPA AEYLYSTPEQLSKRLKSFCKRPDIIRKHLYK 

GEVAPFSWAALHGKFRSLLTTEPREDL
Transcript ENSMUST00000112805
Sequence
ATCTTGCAGGTACAAGATTGGATATCAGTTCATCTGGATCAGAAG - UNI20115 - - UNI24250 - GTTTGAACAGGCCAATGAGTATTGTCAT

CATCGAGGCATTTTATGGAGGCTCCCATCGACAGCTGGTAGAGCTGCTCCGAGAAGAATTAGATGACTGCGTGTTGTACACTCTTCCTGCAAAGAAATGG

CACTGGAGAGCACGCACAGCAGCCTTATACTTCTCACAGAATATTCCCAGCAGTGAGCACTACAG GACCCTCTTTGCAAGCTCAGTACTCAACCTGACT

GAACTGGCTGCCCTTCGGCCTGATCTGGGAAAACTGAAAAAGATCTTATACTTCCATGAAAACCAGTTGGTGTATCCTGTCAAGAAATATCAGGAGAGAG

ATTTTCAATATGGATACAACCAAATTCTCTCGTG - UNI21797 - GGAGCATGACAAAGATCCAGAGACGTTCTTAAAGATACTAATGAGTCTAAAG

CAGTTAAACTTGAACTTCCATGTCTCTGTCCTCGGAGAGACTTTTACAGACACACCAG - UNI21797 - ATATATTTTCAGAAGCCAAAAAGGCACT

GGGCTCTTCAGTCTTGCACTGGGGCTACTTACCCCGTAAAGAAGACTATTTCCGCGTACTGTGCATGGCTGACGTTGTCATCTCAACAGCCAAGCATGAA

TTCTTTGGAGTAGCAAT GTTGGAAGCTGTGTACTGTGGCTGCTACCCACTCTGTCCCAAAGCCTTGGTCTATCCTGAGATCTTTCCAG CTGAGTATCT

GTATTCCACACCTGAACAGCTTTCAAAACGGCTCAAGAGTTTCTGCAAGAGGCCAGATATTATAAGAAAACATCTTTATAAG GGTGAAGTGGCTCCATT

TTCTTGGGCAGCCCTACATGGTAAATTCAGGTCTCTGCTCACAACAGAACCCAGGGAAGATTTGTGACAGATGGGGCTAAGTCGCAAACTTGCAGCCTAA

GGCAGAATCTGAAGAACTTTCCAGAGTGTGCCCATATTTACCTGATCAGAGAGAAAAGAAAATCTGCAGAGGAAGCCGAGCCTGGCTGCTTGTCATAGCT

GACACAGAGCCATCTGCCACAAACCTGTGGCGGCTTCAGATCTCCAATCCCTGCCACCACCCCAACTCAAATTAAATACAGATTCCTAGAGACGTTATGA

TGGTTACACATGTCCTCGGCATCACATGTAGGAGACTGTTCAAAAAAAAATCTGTGGCCTGTTGTATAACCGCACTCATGTATCCCATATGTGGTGCCAC

ATTGAATTTCCGGTTGAATCCGTTTTTATCCTTTGTACTGGATGACACGGAGCCTGAATTCTTTCTTTCTGCCGACACGATGGCAGCCAAACTGCAGCTT

CAAACACTCACACTTGGCTGAGTTTCTACCTGGGTTGCCAGGTTATCATCGGAGCCTTCTTGTGTCCTCAAAGGGCCACGGGGCCTAGAAAGAGGATCAG

AATGCTACTGAACTAATTGGGCAGCCATCTCAAAGCTGCTGTAGGCAAAGGGCTGCTGTAGCACTTTTCTTTTAGCAAATTAATGACTCTCTGGCAAAGG

AGTGTTTAAGTGAAGGCATTAATAAGGGCTCTGGCAGGTATTCCCATGATTCTCAGAGTTCCATTTGCATTGAATTAATCTTAAAGAAACTTGCAAGATA

AACAGCTGGAATTCGGACAAACATGGCAGATTCAGTGAGTGAAGTCCTCTCATCCATAAAATGAACACGAGATACTTGTTTTAAAATTTTTTCCCTGTGG

GTAAAAATAGAAAAATCAGAATGCTTATAACAAAACATAATTTGGTACAAAATTCTTCAAAATACTTGTATCCAACTATAAATATATTCTTCTTGAGATA

AGTCACTTACGATTCTTGCTCTGTTTGTTGGTGTAAAGATGTTTTAAATGGCTGGATTGTAAAATACATTTTTAATAAACTGCCCGCTGCAATTTT
Translation
 - UNI20115 - - UNI24250 - MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYR RTLFASSVLNLT

ELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSW - UNI21797 - WEHDKDPETFLKILMSLKQLNLNFHVSV - UNI21797 -

    
Transcript ENSMUST00000112813
Sequence
ATCTTGCAGGTACAAGATTGGATATCAGTTCATCTGGATCAGAAG - UNI20115 - - UNI24250 - GTTTGAACAGGCCAATGAGTATTGTCAT

CATCGAGGCATTTTATGGAGGCTCCCATCGACAGCTGGTAGAGCTGCTCCGAGAAGAATTAGATGACTGCGTGTTGTACACTCTTCCTGCAAAGAAATGG

CACTGGAGAGCACGCACAGCAGCCTTATACTTCTCACAGAATATTCCCAGCAGTGAGCACTACAG ATTCATGCCCAAGCACAAAATAGCCCACTTAAGG

AGGATGCTCAGCCTTATTGGAGATGCTGCTGCATCTCAGTCTGTGGCGCCTTGTCCCCAGCCAGGGCAGAGGGTTTCTGAGAAGTCACCGGAGAACTGTG

AATCAAAGTCTGATGAACACCCTGACCTTGATGCTGAACAAGAAGCCCTGGACAACCCATCAGTCCATAAATCAGGCTCTCTTCCTGTGAGTAAAGAAAA

CCTGCCTCTTGATCCCAGCACCCTTCTGTGTGGAGCTGAAGATCCGCAAAGACCGCTGCACATTACATGGCCGCACAGGTG - UNI21797 - GGAGC

ATGACAAAGATCCAGAGACGTTCTTAAAGATACTAATGAGTCTAAAGCAGTTAAACTTGAACTTCCATGTCTCTGTCCTCGGAGAGACTTTTACAGACAC

ACCAG - UNI21797 - ATATATTTTCAGAAGCCAAAAAGGCACTGGGCTCTTCAGTCTTGCACTGGGGCTACTTACCCCGTAAAGAAGACTATTTCC

GCGTACTGTGCATGGCTGACGTTGTCATCTCAACAGCCAAGCATGAATTCTTTGGAGTAGCAAT GTTGGAAGCTGTGTACTGTGGCTGCTACCCACTCT

GTCCCAAAGCCTTGGTCTATCCTGAGATCTTTCCAG CTGAGTATCTGTATTCCACACCTGAACAGCTTTCAAAACGGCTCAAGAGTTTCTGCAAGAGGC

CAGATATTATAAGAAAACATCTTTATAAG GGTGAAGTGGCTCCATTTTCTTGGGCAGCCCTACATGGTAAATTCAGGTCTCTGCTCACAACAGAACCCA

GGGAAGATTTGTGACAGATGGGGCTAAGTCGCAAACTTGCAGCCTAAGGCAGAATCTGAAGAACTTTCCAGAGTGTGCCCATATTTACCTGATCAGAGAG

AAAAGAAAATCTGCAGAGGAAGCCGAGCCTGGCTGCTTGTCATAGCTGACACAGAGCCATCTGCCACAAACCTGTGGCGGCTTCAGATCTCCAATCCCTG

CCACCACCCCAACTCAAATTAAATACAGATTCCTAGAGACGTTATGATGGTTACACATGTCCTCGGCATCACATGTAGGAGACTGTTCAAAAAAAAATCT

GTGGCCTGTTGTATAACCGCACTCATGTATCCCATATGTGGTGCCACATTGAATTTCCGGTTGAATCCGTTTTTATCCTTTGTACTGGATGACACGGAGC

CTGAATTCTTTCTTTCTGCCGACACGATGGCAGCCAAACTGCAGCTTCAAACACTCACACTTGGCTGAGTTTCTACCTGGGTTGCCAGGTTATCATCGGA

GCCTTCTTGTGTCCTCAAAGGGCCACGGGGCCTAGAAAGAGGATCAGAATGCTACTGAACTAATTGGGCAGCCATCTCAAAGCTGCTGTAGGCAAAGGGC

TGCTGTAGCACTTTTCTTTTAGCAAATTAATGACTCTCTGGCAAAGGAGTGTTTAAGTGAAGGCATTAATAAGGGCTCTGGCAGGTATTCCCATGATTCT

CAGAGTTCCATTTGCATTGAATTAATCTTAAAGAAACTTGCAAGATAAACAGCTGGAATTCGGACAAACATGGCAGATTCAGTGAGTGAAGTCCTCTCAT

CCATAAAATGAACACGAGATACTTGTTTTAAAATTTTTTCCCTGTGGGTAAAAATAGAAAAATCAGAATGCTTATAACAAAACATAATTTGGTACAAAAT

TCTTCAAAATACTTGTATCCAACTATAAATATATTCTTCTTGAGATAAGTCACTTACGATTCTTGCTCTGTTTGTTGGTGTAAAGATGTTTTAAATGGCT

GGATTGTAAAATACATTTTTAATAAACTGCCCGCTGCAATTTT
Translation
 - UNI20115 - - UNI24250 - MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYR RFMPKHKIAHLR

RMLSLIGDAAASQSVAPCPQPGQRVSEKSPENCESKSDEHPDLDAEQEALDNPSVHKSGSLPVSKENLPLDPSTLLCGAEDPQRPLHITWPHRW - UNI

21797 - WEHDKDPETFLKILMSLKQLNLNFHVSVLGETFTDTPD - UNI21797 - DIFSEAKKALGSSVLHWGYLPRKEDYFRVLCMADVVISTA

KHEFFGVAM MLEAVYCGCYPLCPKALVYPEIFPA AEYLYSTPEQLSKRLKSFCKRPDIIRKHLYK GEVAPFSWAALHGKFRSLLTTEPREDL
Transcript ENSMUST00000049051
Sequence
ATCTTGCAGGTACAAGATTGGATATCAGTTCATCTGGATCAGAAG - UNI20115 - - UNI24250 - GTTTGAACAGGCCAATGAGTATTGTCAT

CATCGAGGCATTTTATGGAGGCTCCCATCGACAGCTGGTAGAGCTGCTCCGAGAAGAATTAGATGACTGCGTGTTGTACACTCTTCCTGCAAAGAAATGG

CACTGGAGAGCACGCACAGCAGCCTTATACTTCTCACAGAATATTCCCAGCAGTGAGCACTACAG GACCCTCTTTGCAAGCTCAGTACTCAACCTGACT

GAACTGGCTGCCCTTCGGCCTGATCTGGGAAAACTGAAAAAGATCTTATACTTCCATGAAAACCAGTTGGTGTATCCTGTCAAGAAATATCAGGAGAGAG

ATTTTCAATATGGATACAACCAAATTCTCTCGTG TTTGGTGGCTGATGTTGTGGTATTCAATTCCAGTTTTAATATGGAATCATTTCTTACTTCTATTG

GAAAATTCCTGAAGCTGATTCCTGATCACAGGCCTAAGGATCTGGAAAGCATTATCAGACCCAAGTGTCAAGTTATTTATTTTCCCATCAGATTTCCTGA

TGTGAGCAG ATTCATGCCCAAGCACAAAATAGCCCACTTAAGGAGGATGCTCAGCCTTATTGGAGATGCTGCTGCATCTCAGTCTGTGGCGCCTTGTCC

CCAGCCAGGGCAGAGGGTTTCTGAGAAGTCACCGGAGAACTGTGAATCAAAGTCTGATGAACACCCTGACCTTGATGCTGAACAAGAAGCCCTGGACAAC

CCATCAGTCCATAAATCAGGCTCTCTTCCTGTGAGTAAAGAAAACCTGCCTCTTGATCCCAGCACCCTTCTGTGTGGAGCTGAAGATCCGCAAAGACCGC

TGCACATTACATGGCCGCACAGGTG - UNI21797 - GGAGCATGACAAAGATCCAGAGACGTTCTTAAAGATACTAATGAGTCTAAAGCAGTTAAAC

TTGAACTTCCATGTCTCTGTCCTCGGAGAGACTTTTACAGACACACCAG - UNI21797 - ATATATTTTCAGAAGCCAAAAAGGCACTGGGCTCTTC

AGTCTTGCACTGGGGCTACTTACCCCGTAAAGAAGACTATTTCCGCGTACTGTGCATGGCTGACGTTGTCATCTCAACAGCCAAGCATGAATTCTTTGGA

GTAGCAAT GTTGGAAGCTGTGTACTGTGGCTGCTACCCACTCTGTCCCAAAGCCTTGGTCTATCCTGAGATCTTTCCAG CTGAGTATCTGTATTCCAC

ACCTGAACAGCTTTCAAAACGGCTCAAGAGTTTCTGCAAGAGGCCAGATATTATAAGAAAACATCTTTATAAG GGTGAAGTGGCTCCATTTTCTTGGGC

AGCCCTACATGGTAAATTCAGGTCTCTGCTCACAACAGAACCCAGGGAAGATTTGTGACAGATGGGGCTAAGTCGCAAACTTGCAGCCTAAGGCAGAATC

TGAAGAACTTTCCAGAGTGTGCCCATATTTACCTGATCAGAGAGAAAAGAAAATCTGCAGAGGAAGCCGAGCCTGGCTGCTTGTCATAGCTGACACAGAG

CCATCTGCCACAAACCTGTGGCGGCTTCAGATCTCCAATCCCTGCCACCACCCCAACTCAAATTAAATACAGATTCCTAGAGACGTTATGATGGTTACAC

ATGTCCTCGGCATCACATGTAGGAGACTGTTCAAAAAAAAATCTGTGGCCTGTTGTATAACCGCACTCATGTATCCCATATGTGGTGCCACATTGAATTT

CCGGTTGAATCCGTTTTTATCCTTTGTACTGGATGACACGGAGCCTGAATTCTTTCTTTCTGCCGACACGATGGCAGCCAAACTGCAGCTTCAAACACTC

ACACTTGGCTGAGTTTCTACCTGGGTTGCCAGGTTATCATCGGAGCCTTCTTGTGTCCTCAAAGGGCCACGGGGCCTAGAAAGAGGATCAGAATGCTACT

GAACTAATTGGGCAGCCATCTCAAAGCTGCTGTAGGCAAAGGGCTGCTGTAGCACTTTTCTTTTAGCAAATTAATGACTCTCTGGCAAAGGAGTGTTTAA

GTGAAGGCATTAATAAGGGCTCTGGCAGGTATTCCCATGATTCTCAGAGTTCCATTTGCATTGAATTAATCTTAAAGAAACTTGCAAGATAAACAGCTGG

AATTCGGACAAACATGGCAGATTCAGTGAGTGAAGTCCTCTCATCCATAAAATGAACACGAGATACTTGTTTTAAAATTTTTTCCCTGTGGGTAAAAATA

GAAAAATCAGAATGCTTATAACAAAACATAATTTGGTACAAAATTCTTCAAAATACTTGTATCCAACTATAAATATATTCTTCTTGAGATAAGTCACTTA

CGATTCTTGCTCTGTTTGTTGGTGTAAAGATGTTTTAAATGGCTGGATTGTAAAATACATTTTTAATAAACTGCCCGCTGCAATTTT
Translation
TRLDISSSGSEG - UNI20115 - - UNI24250 - GLNRPMSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSS

EHYR RTLFASSVLNLTELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSC CLVADVVVFNSSFNMESFLTSIGKFLKLIPDHRPKDL

ESIIRPKCQVIYFPIRFPDVSR RFMPKHKIAHLRRMLSLIGDAAASQSVAPCPQPGQRVSEKSPENCESKSDEHPDLDAEQEALDNPSVHKSGSLPVSK

ENLPLDPSTLLCGAEDPQRPLHITWPHRW - UNI21797 - WEHDKDPETFLKILMSLKQLNLNFHVSVLGETFTDTPD - UNI21797 - DIFSE

AKKALGSSVLHWGYLPRKEDYFRVLCMADVVISTAKHEFFGVAM MLEAVYCGCYPLCPKALVYPEIFPA AEYLYSTPEQLSKRLKSFCKRPDIIRKHL

YK GEVAPFSWAALHGKFRSLLTTEPREDL

For any suggestions or comments, please send an email to unitrap@crg.es