Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036912 (Piwil4)
Chromosomal location
Chr 9: 14500674 - 14545177 (-)
Description
piwi-like homolog 4 (Drosophila) Gene [Source:MGI (curated);Acc:Piwil4-001]
RefSeq_dna
NM_177905 
RefSeq_peptide
NP_808573.2 
UniGene
Mm.334969 
MGI
MGI:3041167 
Uniprot/SWISSPROT
Q8CGT6 
Uniprot/SPTREMBL
A6X964 A6P4B9 A6X963 
Human Ortholog
ENSG00000134627 (PIWIL4)
Omim not available
UniTrap UNI34196
Vector Insertion
Chr 9: 14534318 - 14539102
Public Clones IST12253E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115643
Sequence
CTACTTCACAGTGCCCTGCATGGGGTCAGCTTACTGATTTGAGTGGAAAGCATGCTTAAACAGGGCCAGCCCCTCTGCCTGTGCTCACTCTCTGCACTCA

CCTTTGCTTGCCTCTCCCAGGCCTGAGCAGCCAAGCAACCTCAGATTTCCGCCTGATGAAGGCAGTAGCTGAAGAGACTCGGCTCAGTCCTGTGGGAAGG

CAGCAGCAGCTGGCCCGACTCGTGGATGACATCCAGAG GAACCCAGTGGCTCGGTTTGAGCTTGAGACCTGGGGATTGCATTTTGGAAGCCAGCTATCC

CTGACCGGCCGGGTTGTTCCCTCTGAAAAAATCCTGCTGCAGGACCACACA TGTCAACCTGCATTTGCTGCTGACTGGTCCAAAGATATGCGATCTTGC

AAAGTTTTGAGTTCTCAGCCTTTGAATAGATGGTTGATCGTGTGCTGTAACAGGGCTGAGCACTTGATTGAAGCCTTTCTGAGCTGTCTGAGGAGAGTTG

GAGGTTCCATGGGATTTAACGTGGGCTACCCCAAAAT CATAAAAGTGGACGAGACCCCAGCAGCGTTCCTTCGAGCCATCCAGGTGCACGGCGACCCCG

ATGTTCAGTTG GTGATGTGCATTCTGCCTTCTAATCAGAAGAACTATTACGACTCCATTAAAAAGTATTTGAGCTCTGACTGCCCAGTGCCAAGCCAGT

GTGTGCTGACCCGGACCTTGAATAAGCAGGGAACGATGCTGAGTGTGGCCACCAAGATCGCCATGCAGATGACCTGCAAACTTGGCGGAGAGCTGTGGTC

TGTGGAGATCCCA TTGAAGTCCCTGATGGTCGTGGGTATTGATATCTGCAGAGATGCCCTCAACAAGAATGTGGTGGTCGTCGGGTTTGTAGCCAGCAT

TAATTCCAGGATCACCAG GTGGTTTTCCCGCTGTGTCCTTCAGAGAACAGCGGCTGATATTGCAGATTGCCTCAAAGTCTGCATGACTG GTGCTCTCA

ACCGGTGGTACAGACACAACCATGACTTGCCGGCACGGATAGTCGTGTACCGGGACGGTGTAGGCAATGGCCAGCTAAAGGCAGTTTTGGAATATGAAGT

CCCACAGCTACTGAAAAGTGTAACAGAGTGCGGCTCGGATGCCAG GAGCTGCAGACTGTCCGTGGTTGTGGTCAGGAAGAGATGTCTACTGCGCCTCTT

TGCTTCGACTGACCACACTGTGCAGAACCCCCCACTCGGCACTGTTGTGGACTCAGAAGCAACACGTCCGGAGTG GTATGACTTCTACCTGATCAGCCA

GACTGCTAACCGGGGGACTGTTAGTCCCACCCACTACAACGTTATCTATGATGACAATGCCTTGAAGCCTGACCACATGCAGCGACTGACCTTCAAACTG

TGCCATCTCTACTACAACTGGCAG GGCTTAATCAGTGTCCCCGCACCATGCCAATATGCACACAAGCTGACCTTCCTGGTGGCACAAAGTGTCCACAAG

GAACCAAGTCTGGAATTAGCCAATAATCTTTTCTACCTCTGACAAGTGAGCCAGAGGACGGCTTGAGACTCCGAAAGCAGTGGCTCTGCGTTGTTCAGAT

CTGCCTACCGCTCAGGCTCCTGCGGCTTACGGGGCTTGGGCCTAACTTTAAGTATTGGGAAGGGGGGGTTGTTTTGTTTTGTTTTGTTTTGTTTTTTAAA

AAAAAAACTCATTTGAAAAAGTTCAGAACAAACCTATGGGGATTTTTGTTTCACTTGTGTCTAAAACCAACAAAGACAAACAAACAGAACCCACAGAGTG

ATGGGTTTTCTTGTGGCTTTGTCATGTGTCATTTTACTTTGGCCTGGTTCAGCCTTGTATTTCTCTTCTCTTCTCTTCTCTTCTCTTCTCTTCTCTTCTT

TTCTTTCTTTCTTTTTCTTTTTTTTAAGTCAGTGCTTGAGGTAAATTCTCATGTGGTACTTGGGATATATCATCACAGCTTCTAAAACAATATTTGTGTG

GTATTTTGATGGTACATAGTGGGGTTTAACTTCAGGAAATTATCAGAGTTTTTCTAAACATTGTAGAGCATTTTGTAGAGTGGGTTAAGTAAATATTGAA

AATAAAGAAAATCTAAGCATC
Translation
MKAVAEETRLSPVGRQQQLARLVDDIQR RNPVARFELETWGLHFGSQLSLTGRVVPSEKILLQDHT CQPAFAADWSKDMRSCKVLSSQPLNRWLIVCC

NRAEHLIEAFLSCLRRVGGSMGFNVGYPKI IIKVDETPAAFLRAIQVHGDPDVQL VMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTML

SVATKIAMQMTCKLGGELWSVEIP LKSLMVVGIDICRDALNKNVVVVGFVASINSRITR RWFSRCVLQRTAADIADCLKVCMTG GALNRWYRHNHDL

PARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDAR RSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEW WYDFYLISQTANRGT

VSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL
Transcript ENSMUST00000115644
Sequence
CCGGGCCCTGCCCACCCACGCTCGGGTTGCTGTTTGTAGTAACTATCTTGGGAAGCTTGAATACTCCCAAACTCCGAGTCACAGCCACACCGTCTCTTTT

GCCAAAGAGAAAACACTCCTGTTGAGGCTCACCAGCCCTGGAAAGCCGCTGGCACCCAGGAACATGAGTGGACGGGCCCGTGTGAGAGCGCGAGGCATCA

CCACTGGCCACAGTGCTAGGGAAGTGGGGCGGTCCTCAAGAGACCTCATG GTTACATCTGCCAGTCCTGGGGACAGCGAGGCCGGAGGTGGGACAAGTG

TCATTTCACAGCCAT ATGAACTTGGTGTCTCTTCTGGTGATGGTGGACGTACCTTCATGGAAAGAAGAGGCAAAGGCAGACAGGACTTCGAAGAGTTGG

GTGTCTGTACCAGGGAAAAGTTGACCCACGTAAAAGATTGTAAAACAG - UNI34196 - GTTCTAGCGGAATACCTGTGCGGCTGGTTACAAATCTC

TTTAATTTAGATTTGCCCCAGGATTGGCAGCTGTACCAGTACCATGTCACGTACAGCCCAGATTTAGCCTCTAGGAGGCTGAGGATTGCTTTGCTTTATA

ATCACAGCATACTCTCAGACAAGGCAAAAGCATTTGACGGTGCCAGCCTTTTCCTCTCAGAAAAGCTGGACCAGAAG - UNI34196 - GTCACAGAA

CTGACAAGTGAAACACAAAGAGGTGAGACTATAAAGATAACGCTCACCCTAACGAGCAAGCTCTTCCCAAACTCCCCTGTGTGCATTCAGTTCTTCAATG

TCATCTTCAGAAA - UNI34196 - GATCTTGAAAAACTTGAGTATGTACCAAATTGGACGGAACTTCTATAAGCCTTCAGAACCAGTGGAGATCCCT

CAGTACAA ATTGTCCCTGTGGCCTGGGTTTGCCATTTCTGTGTCTCACTTTGAAAGCAAGCTCCTATTCAATGCTGACGTGAACTACAAAGTCCTCCGC

AATGAGACCGTTCTGGACTTCATGACTGATCTCTGCCTCAGAACTGGCATGTCTTGCTTCACCGAGATGTGCCACAAACAACTAGTGGGGCTCGTTGTCC

TTACCAG ATACAACAACAAAACATATCGTATCGATGACATTGACTGGTCTGTGAAGCCCACACAGGCCTTTCAGAAGCGGGACGGCTCAGAGGTCACAT

ATGTGGATTACTACAAGCAG CAATATGATATCACCTTATCTGACCTAAATCAGCCAGTGCTTGTTAGTCTGTTGAAAAGAAAGAGAAATGATAACTCTG

AGCCTCAGATGGTCCACCTGATGCCAGAGCTCTGCTTTCTCACAG GCCTGAGCAGCCAAGCAACCTCAGATTTCCGCCTGATGAAGGCAGTAGCTGAAG

AGACTCGGCTCAGTCCTGTGGGAAGGCAGCAGCAGCTGGCCCGACTCGTGGATGACATCCAGAG GAACCCAGTGGCTCGGTTTGAGCTTGAGACCTGGG

GATTGCATTTTGGAAGCCAGCTATCCCTGACCGGCCGGGTTGTTCCCTCTGAAAAAATCCTGCTGCAGGACCACACA TGTCAACCTGCATTTGCTGCTG

ACTGGTCCAAAGATATGCGATCTTGCAAAGTTTTGAGTTCTCAGCCTTTGAATAGATGGTTGATCGTGTGCTGTAACAGGGCTGAGCACTTGATTGAAGC

CTTTCTGAGCTGTCTGAGGAGAGTTGGAGGTTCCATGGGATTTAACGTGGGCTACCCCAAAAT CATAAAAGTGGACGAGACCCCAGCAGCGTTCCTTCG

AGCCATCCAGGTGCACGGCGACCCCGATGTTCAGTTG GTGATGTGCATTCTGCCTTCTAATCAGAAGAACTATTACGACTCCATTAAAAAGTATTTGAG

CTCTGACTGCCCAGTGCCAAGCCAGTGTGTGCTGACCCGGACCTTGAATAAGCAGGGAACGATGCTGAGTGTGGCCACCAAGATCGCCATGCAGATGACC

TGCAAACTTGGCGGAGAGCTGTGGTCTGTGGAGATCCCA TTGAAGTCCCTGATGGTCGTGGGTATTGATATCTGCAGAGATGCCCTCAACAAGAATGTG

GTGGTCGTCGGGTTTGTAGCCAGCATTAATTCCAGGATCACCAG GTGGTTTTCCCGCTGTGTCCTTCAGAGAACAGCGGCTGATATTGCAGATTGCCTC

AAAGTCTGCATGACTG GTGCTCTCAACCGGTGGTACAGACACAACCATGACTTGCCGGCACGGATAGTCGTGTACCGGGACGGTGTAGGCAATGGCCAG

CTAAAGGCAGTTTTGGAATATGAAGTCCCACAGCTACTGAAAAGTGTAACAGAGTGCGGCTCGGATGCCAG GAGCTGCAGACTGTCCGTGGTTGTGGTC

AGGAAGAGATGTCTACTGCGCCTCTTTGCTTCGACTGACCACACTGTGCAGAACCCCCCACTCGGCACTGTTGTGGACTCAGAAGCAACACGTCCGGAGT

G GTATGACTTCTACCTGATCAGCCAGACTGCTAACCGGGGGACTGTTAGTCCCACCCACTACAACGTTATCTATGATGACAATGCCTTGAAGCCTGACC

ACATGCAGCGACTGACCTTCAAACTGTGCCATCTCTACTACAACTGGCAG GGCTTAATCAGTGTCCCCGCACCATGCCAATATGCACACAAGCTGACCT

TCCTGGTGGCACAAAGTGTCCACAAGGAACCAAGTCTGGAATTAGCCAATAATCTTTTCTACCTCTGA
Translation
MSGRARVRARGITTGHSAREVGRSSRDLM VTSASPGDSEAGGGTSVISQPY YELGVSSGDGGRTFMERRGKGRQDFEELGVCTREKLTHVKDCKTG -

 UNI34196 - GSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQK - UNI34196 - VT

ELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRK - UNI34196 - KILKNLSMYQIGRNFYKPSEPVEIPQYK KLSLWPGFAISVSHFESK

LLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTR RYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQ QYDITLSDLNQ

PVLVSLLKRKRNDNSEPQMVHLMPELCFLTG GLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQR RNPVARFELETWGLHFGSQLSLTGRVV

PSEKILLQDHT CQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKI IIKVDETPAAFLRAIQVHGDPDVQL

 VMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIP LKSLMVVGIDICRDALNKNVVVVGFVASINS

RITR RWFSRCVLQRTAADIADCLKVCMTG GALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDAR RSCRLSVVVVRKRCLL

RLFASTDHTVQNPPLGTVVDSEATRPEW WYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ GLISVPAPCQYAHKLTFLVA

QSVHKEPSLELANNLFYL
Transcript ENSMUST00000076946
Sequence
ATGCGCCTGCGCATTCTGGGGGTCCACCGGGCCCTGCCCACCCACGCTCGGGTTGCTGTTTGTAGTAACTATCTTGGGAAGCTTGAATACTCCCAAACTC

CGAGTCACAGCCACACCGTCTCTTTTGCCAAAGAGAAAACACTCCTGTTGAGGCTCACCAGCCCTGGAAAGCCGCTGGCACCCAGGAACATGAGTGGACG

GGCCCGTGTGAGAGCGCGAGGCATCACCACTGGCCACAGTGCTAGGGAAGTGGGGCGGTCCTCAAGAGACCTCATG GTTACATCTGCCAGTCCTGGGGA

CAGCGAGGCCGGAGGTGGGACAAGTGTCATTTCACAGCCAT ATGAACTTGGTGTCTCTTCTGGTGATGGTGGACGTACCTTCATGGAAAGAAGAGGCAA

AGGCAGACAGGACTTCGAAGAGTTGGGTGTCTGTACCAGGGAAAAGTTGACCCACGTAAAAGATTGTAAAACAG - UNI34196 - GTTCTAGCGGAA

TACCTGTGCGGCTGGTTACAAATCTCTTTAATTTAGATTTGCCCCAGGATTGGCAGCTGTACCAGTACCATGTCACGTACAGCCCAGATTTAGCCTCTAG

GAGGCTGAGGATTGCTTTGCTTTATAATCACAGCATACTCTCAGACAAGGCAAAAGCATTTGACGGTGCCAGCCTTTTCCTCTCAGAAAAGCTGGACCAG

AAG - UNI34196 - GTCACAGAACTGACAAGTGAAACACAAAGAGGTGAGACTATAAAGATAACGCTCACCCTAACGAGCAAGCTCTTCCCAAACTC

CCCTGTGTGCATTCAGTTCTTCAATGTCATCTTCAGAAA - UNI34196 - GATCTTGAAAAACTTGAGTATGTACCAAATTGGACGGAACTTCTATA

AGCCTTCAGAACCAGTGGAGATCCCTCAGTACAA CAAGCTCCTATTCAATGCTGACGTGAACTACAAAGTCCTCCGCAATGAGACCGTTCTGGACTTCA

TGACTGATCTCTGCCTCAGAACTGGCATGTCTTGCTTCACCGAGATGTGCCACAAACAACTAGTGGGGCTCGTTGTCCTTACCAG ATACAACAACAAAA

CATATCGTATCGATGACATTGACTGGTCTGTGAAGCCCACACAGGCCTTTCAGAAGCGGGACGGCTCAGAGGTCACATATGTGGATTACTACAAGCAG C

AATATGATATCACCTTATCTGACCTAAATCAGCCAGTGCTTGTTAGTCTGTTGAAAAGAAAGAGAAATGATAACTCTGAGCCTCAGATGGTCCACCTGAT

GCCAGAGCTCTGCTTTCTCACAG GCCTGAGCAGCCAAGCAACCTCAGATTTCCGCCTGATGAAGGCAGTAGCTGAAGAGACTCGGCTCAGTCCTGTGGG

AAGGCAGCAGCAGCTGGCCCGACTCGTGGATGACATCCAGAG AACCTTACCTTCTTCTCAAGAAGTTCTCTCTCATACTTCCTTGCCTTTGTGGGCCCC

AGAGCCAGGAGGACTTAGCAGTGCTATACCACTGAGCACTGTGCTTCCCTTTGCCCAGCAGCTGTTAACTGCCCTGAGCCTCTCCCCGGGAATCCCTCTG

CCCCACCTCAAGCCTCCCTCCTTCCTGTTCTTG TGTCAACCTGCATTTGCTGCTGACTGGTCCAAAGATATGCGATCTTGCAAAGTTTTGAGTTCTCAG

CCTTTGAATAGATGGTTGATCGTGTGCTGTAACAGGGCTGAGCACTTGATTGAAGCCTTTCTGAGCTGTCTGAGGAGAGTTGGAGGTTCCATGGGATTTA

ACGTGGGCTACCCCAAAAT CATAAAAGTGGACGAGACCCCAGCAGCGTTCCTTCGAGCCATCCAGGTGCACGGCGACCCCGATGTTCAGTTG GTGATG

TGCATTCTGCCTTCTAATCAGAAGAACTATTACGACTCCATTAAAAAGTATTTGAGCTCTGACTGCCCAGTGCCAAGCCAGTGTGTGCTGACCCGGACCT

TGAATAAGCAGGGAACGATGCTGAGTGTGGCCACCAAGATCGCCATGCAGATGACCTGCAAACTTGGCGGAGAGCTGTGGTCTGTGGAGATCCCA TTGA

AGTCCCTGATGGTCGTGGGTATTGATATCTGCAGAGATGCCCTCAACAAGAATGTGGTGGTCGTCGGGTTTGTAGCCAGCATTAATTCCAGGATCACCAG

 GTGGTTTTCCCGCTGTGTCCTTCAGAGAACAGCGGCTGATATTGCAGATTGCCTCAAAGTCTGCATGACTG GTGCTCTCAACCGGTGGTACAGACACA

ACCATGACTTGCCGGCACGGATAGTCGTGTACCGGGACGGTGTAGGCAATGGCCAGCTAAAGGCAGTTTTGGAATATGAAGTCCCACAGCTACTGAAAAG

TGTAACAGAGTGCGGCTCGGATGCCAG GTATGACTTCTACCTGATCAGCCAGACTGCTAACCGGGGGACTGTTAGTCCCACCCACTACAACGTTATCTA

TGATGACAATGCCTTGAAGCCTGACCACATGCAGCGACTGACCTTCAAACTGTGCCATCTCTACTACAACTGGCAG GGCTTAATCAGTGTCCCCGCACC

ATGCCAATATGCACACAAGCTGACCTTCCTGGTGGCACAAAGTGTCCACAAGGAACCAAGTCTGGAATTAGCCAATAATCTTTTCTACCTCTGA
Translation
MRLRILGVHRALPTHARVAVCSNYLGKLEYSQTPSHSHTVSFAKEKTLLLRLTSPGKPLAPRNMSGRARVRARGITTGHSAREVGRSSRDLM VTSASPG

DSEAGGGTSVISQPY YELGVSSGDGGRTFMERRGKGRQDFEELGVCTREKLTHVKDCKTG - UNI34196 - GSSGIPVRLVTNLFNLDLPQDWQLY

QYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQK - UNI34196 - VTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIF

RK - UNI34196 - KILKNLSMYQIGRNFYKPSEPVEIPQYN NKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTR RYN

NKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQ QYDITLSDLNQPVLVSLLKRKRNDNSEPQMVHLMPELCFLTG GLSSQATSDFRLMKAVAEETR

LSPVGRQQQLARLVDDIQR RTLPSSQEVLSHTSLPLWAPEPGGLSSAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFL CQPAFAADWSKDMRS

CKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKI IIKVDETPAAFLRAIQVHGDPDVQL VMCILPSNQKNYYDSIKKYLSSDCPV

PSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIP LKSLMVVGIDICRDALNKNVVVVGFVASINSRITR RWFSRCVLQRTAADIADCLKVC

MTG GALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTECGSDAR RYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLC

HLYYNWQ GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL
Transcript ENSMUST00000040739
Sequence
GTTGCAGGAGCTGCAGACTGTCCGTGGTTGTGGTCAGGAAGAGATGTCTACTGCGCCTCTTTGCTTCGACTGACCACACTGTGCAGA CCCCCACTCGGC

ACTGTTGTGGACTCAGAAGCAACACGTCCGGAGTG GTATGACTTCTACCTGATCAGCCAGACTGCTAACCGGGGGACTGTTAGTCCCACCCACTACAAC

GTTATCTATGATGACAATGCCTTGAAGCCTGACCACATGCAGCGACTGACCTTCAAACTGTGCCATCTCTACTACAACTGGCAG TCTTGTCATGGAATC

CAGGCTGCTCTAAAACCTGTAACAGTACCCCTGCCTCAGCTCCTGAGTACTGGCACTATGCAG TAATCGTGTCTCATTTTCTATTTAAAACCTTTGGGA

GGAATGAAGATGACAAAGCGACATCGTGACTGTGGCTCCTTCCATGTGGCACAGAACAGAGGCTGTAGACTCGGACCATTTCTTCCCAGCGGAAGACTCC

GCCATCTCGCGGCCTTGAGTACTCTTGAACGTGGCCAAGTCTATCTCAGAGATGTGCTAGAATTTCTGGCTCTGTCTACCGCTCCTCCTTCTTTCCTGTC

CCCTTTTACTGGTGGCAGCTGGGTGCTTGCCCAGGCTCTCTTCCACCTCTTCTTCCTATGGCCCCACCCCATTGATTCCCTGACATGTTTCTGTCTTCCT

GTCTACTGCTTGGGAGACCCAATTCTCTTTGTGATGCCAATCTTGTTTTTTTAATAAAAAGCACTTTTAGTCTTAAAATGCCTACTAATCAAAACACGAA

ATCTAAAAGAAACATTCTACCATGGGATGCCATAACCTTCTAACTGCAGGGAATTAATTTAGCAATTTCCCATGGGAAAATTGACTCATAAATCTTAGCT

CACTTCAAGATCCCAAACACGAAATGTCATCTGCTCTTGAAGCTTATTGTCAAATGTCAGGGTTCTGTTGCTCATATTAACCTGTGCTTGGCACACCGAT

TTGACCCAGTGCACACCGGCCAAGAACAAGCCGGCCGCTGTTTCTGGAAGGGTGAAGAGAAGACTCATTTCTAATGAAGAAAGGATAAAGAGTAGATAAA

AGAGAAGATAGAGACCCTTCCTATGTACTTTGTATTGAAGTTTTGATTTGTTTGTGTAACCATTAGCCTTTAATTATGAAAATTATAGATGGACATTATA

CAACATGTGGAAAAAAAAAACAGTAGAAAAAAAGTCCCCAACATTGGTATTAGCCAGTGAACATGGTCAACACTTGGACTTCACTCCCTTAGGTATACTG

CACATGTAGTTTTGTAAACTTTGTTATCAAAATAAAGTCATAGTATGTATAGTTTTCTATTTGATTGCAGATTTTCCGTAGGCATGTTTTAGTGACTAAT

AACTTACTGTGTAAATGTAACAAATACTTTTCTCTGTTTTTGTTGTATTTTAAGTTATTTCTTGCTATGGGAACATGGCATACAGTTTTTCTCTCCATGT

GATTTGGGATGGCTTCCTTAGATTAGGACTCTAAAAGACAAATTACCAAGTCAAAAAGTTATAATACTTAAAAAATTAATCTTTATTATTAATATTGCTT

TATGTGTGATTTGTCTTACCTGCACATACATCTGTGCACCATGTGTGTGCAATGCCCACAGAGGCCAGAAGAGGACATTGGATTTCCTGGAACTGGAATT

ACAGATGTTTGTGAGCTGCTGTGTAGGTGGTGGGAACTGAACCTTGGTCCCGGGCAAAAGTAGCCAGAGCTCTCAAGTCCTGAGTCATGGCTCCAGCTAT

TCTCATATGTATGTATGCTAATACACTAGAGGCTGGTACTATACTACACATTGAATACATTAGAAGCTGTTAATATACATTGCCAGCTTCTCCCTAAAAT

GCCACAGGTACTGTGCTCCCAGGATGGTACTATGGTAGAATTTGCATATTCCACCAAGCCAAAAAGGATGGCTTTTGTTACTGGCATTACTTTCATGTGT

TTATTGGATTAGTAAGTAAATACAAATTGAAGTT
Translation
VAGAADCPWLWSGRDVYCASLLRLTTLCR PPLGTVVDSEATRPEW WYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ SC

HGIQAALKPVTVPLPQLLSTGTMQ Q

For any suggestions or comments, please send an email to unitrap@crg.es