Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036964 (Trim17)
Chromosomal location
Chr 11: 58768187 - 58786600 (+)
Description
tripartite motif-containing 17 Gene [Source:MGI (curated);Acc:Trim17-002]
RefSeq_dna
NM_031172 
RefSeq_peptide
NP_112449.1 
UniGene
Mm.460331 Mm.462157 
MGI
MGI:1861440 
Uniprot/SWISSPROT
Q7TPM3 
Uniprot/SPTREMBL
A2AB81 A2AB82 
Human Ortholog
ENSG00000162931 (TRIM17)
Omim not available
UniTrap UNI5624
Vector Insertion
Chr 11: 58768895 - 58777282
Public Clones CSI796 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047697
Sequence
GTTTTCGCTAGGTTTCTTTTCTGTTTTTGCGTACTTTTGGTTATCAGTGGAAGATGTCTGGTCGTGGCAAGCAGGGCGGCAAAGCTCGTGCAAAAGCGAA

GTCTCGTTCTTCCCGTGCCGGCCTGCAGTTTCCAGTGGGCCGTGTGCACCGCCTTCTCCGTAAGGGTAATTATTCGGAGCGGGTCGGCGCTGGTGCCCCG

GTGTACCTGGCGGCTGTGCTAGAATATCTGACTGCTGAGATCCTGGAATTGGCTGGTAATGCGGCCCGCGACAATAAGAAGACGCGAATCATCCCGCGCC

ACCTGCAGTTGGCCATCCGCAACGACGAGGAGCTCAACAAGCTGCTGGGCCGCGTGACCATCGCGCAGGGCGGCGTCCTGCCCAACATCCAGGCCGTGCT

ACTGCCCAAGAAGACCGAGAGCCACCACAAGGCCAAGGGCAAGTGAGGCCCCTACCGGTCGTTAGTGCGACTTTTACAGACACCAAAGGCTCTTTTCAGA

GCCACCCACAACCTCATTAGAAAGCGCTGTACACTGAGCCTGTCGCCAGTTACTGGCCAGGCCAGTTCTCCTGACTCCTTCCGTGCATTCCTGCATCCCT

GTGCGGCGCTTGGGGAGCTCAAGGGAGACCAACGGCTTCATCTGCGGGTGGCCTGCGGGCCGTTGGAGGCGTTCGAGTTTCTCCCCACCACTCCGTGTCA

GACACAAG - UNI5624 - GAGCCATGGATGCGGTGGAGCTTGCCAGACGGTTACAAGAGGAGGCCACATGTTCCATCTGCCTTGACTACTTTACTGA

TCCTGTGATGACTGCCTGTGGCCACAACTTCTGCAGAGAGTGCATCCAGATGAGCTGGGAGAAGGGGAAGGTCAAGAAAGGGAAGAAGAAGCAGAAGGGC

TCCTTCCCCTGCCCCGAGTGCAGGGAGATGTCCCCTCAGAGGAACCTGAGGCCCAACCGCCTCCTGACAAAAGTGGCTGAGATGGCCCGCCAGCACCCTG

GGCTGCAGAAGCGAGACCTGTGCCAAGCACACCAAGAACCCCTTAAGCTGTTCTGCCAGGATGACCAGAGCCCCATTTGTGTGGTCTGCAGGGAGGCCCA

GGAGCACCGGATGCACAGGGTGCTGCCTCTGGATGAGGCTGCAAGGGAGTATAAG CTCAAGTTGGAGGAGGACATAAAATATCTACGGGAGGAGATGAT

GAAGACGGAGACACTGCAAGCCAAGGAGGAACAGACCTTAACTGAGTGGCAG GAGAGAGTGAAAGAGCGGAGAGAACGCATCCTGGAGGAGTTTCAGAA

GGTGGTCTTGTTTCTGGTGGAAGAAGAACGGAGGATCCTCCAGGTCCTGAAGAAGGAGGAAGAGGACACCTTAGGGAAGCTGCAGGACAGCAAGGCCTCC

CTGGACCACCAAAGCCGCTCCCTGGACCTGATCCTGTTGCAGCTGGAGGAGCGGAGCCAGCAGGAGCCCCTCCAGATGCTGCAG GATGTGAAGGACACC

TTGAACAG GAGAGCTTCAGCGTGCAGTACCCAGAGGTGGTCCTCCCCGCGGCTATCAAGACCTTGTGCAGAGTTCCAGGACAGATAGAGGTGCTCAAAA

GCTTCCAAG AGGATGTGATGCCGGACCCCAGCTCAGCATACCCCTATCTCCTCCTCTACGAGAGTCGCCAGAGGCGGTACTTGAGCCCACCGCCCGAGG

GCAGCGCCCCCTACAGCAAGGACCGGTTCGTGGCCTACCCGTGCGCTGTGGGGCAGAAGAGCTTTTCCTCTGGAAGGCACTACTGGGAAGTGGGCATGAA

TCTCACCGGGGATGCACTCTGGGCCTTGGGGGTGTGCAGGGACAACGTGAGTCGGAAGGACAGAGTGCTTAAGTCCCCAGAAAACGGCTTCTGGGTAGTG

CAGCTGTCCAAGGGGAAAAAACAGCTGTCCCTGTTACCCAATTCCACTCTAGTCACTCTCACAGAGCCTCCCAGCCACATGGGGATCTTCCTGGACTTCC

AGGCTGGAGAGGTGTCCTTCTACAGCGTGAACGATGGGTCCCACTTACACAGCTTTTCCCAGGCTGCCTTCCCTGGGCCGCTGCTGCCATTCTTCTGCTT

GGGGGCTCCCAAGTCAGGCCAGATGGTCATCTCCACAGTGACCATGTGGGTGAAGGGATAGAGGCTTGAAGCCGGGCAGACACTGGGTGTGCCACAGTTC

CCCAGAAGGCAGGGTGCTTCACCACCGTGGCCACCTACCCAGGCTTCCCTGGGGCACTAAGAGTTAATACCTGTGCTGGCAGGGTAACTGAAATACAGTC

AAGATTCAAATGCTCAAGTGAGACCGACTACAGATAAGATGCTAAATGGGGGAACTTTGGAAAGGGTCCTGCTTATCTCAGAGTGGACTCAATTCTTTTC

TAACACCCTTCCCCAAGAACCCCTCCCACTTCCCATTCCTGTTAAAAGTTACTAGCATGCCAGGACTCAAGTGAGATGGTGAACTGGCATAGCACATGTT

TCCACTGTGACCCTTCTGTGCCCATGGTGTGACATGTATCTTGTCTCCCATTGGGGTCAGTCAACCACAGACATGAGGGTGGCACTGGAGGCTCTGAGCA

ACAACAGGTGCTGCGGGCTATGAACACAGAGTAAAAGTGCAGAGGGAAACCACCGACTCCCTTGGTCACCACTCTCAGGGTTTTCCATGTCCTTGAGGTC

ATCCTGCCCATCAGTAGTACTCTGCATCCTTTTCTGAGCCCTGGAGTTACGCACTTGTGCATGCTTGTGTCTATCCTCACAGCCCCTGCTCCCAGGATAA

CTCTGAGACTCAGATATATTTAGATACCTAGGCCATAAACCTTGGCTGTTCCCTAACTAGCTCATAAGCTAATCTTCCCGTTACTCTAAGGTCTGCCACA

TGGTTGATAACCTGGTCCTCAGGTTTTGCTGCTGTACATATCAGCATTCGGGGGTCAATCTTCCACCTGTCTCTATCCCAGCATCCCCCTCCTGCTCTGT

CTGATGTCCCATCTAATTTCCTGCCTCAGCTCATTGGCCAATAAGCCTTTTATTGACAGGTGAATGCTTTTACACAGTGAACAAGAGTTTCTCTCTACAT

TTCCCCCTTTTAGTCCAAGAAAAGGCTCCTTTTCTTACAAAATAAACTATATACAATAACCATTGTAGTGCTCAGCCCATATGTTCCAAAACTATAGACA

TGACAAGTTAGCTGCTTTGACAGTCCCTCAGAATTCCTGTATAATGGTGGAACTTCAGTCTTCAGCCCTCTGGCACCGTATAACTGACAGACTTTTCTGT

GCAGCAGGAATGATGAAGGACTTAGCTATCTTGTTCTTGCAAAGCTTGGCAGTTGAGTTCCCTGCATCCCAGTTTGTCCATTCCGGACAGCATTCAGTCA

GCATTTGAAGCACGGACAGTTTCTTGCACAGTGGCAGTGGCCACATTTGAAACAAACTCCATAGGGAGATTCTTTGATGCTCAACTTTCTTTGAAGTAGA

AAAACGGGTCCTGTTGCCAAAAAGCCTTTTAATAATAAAACATCTTTAAATGTCATATTCTGTAGATCTCTGATGTTTCCAAAAACCATCTATAACTGAA

TTGTCTGTTTCTAGTTAGTCACTATTTGATTATTAGTCTTGAAAACATCTACTGGAGGCTAAATAAAACTTATTTTGAAAAT
Translation
 - UNI5624 - MDAVELARRLQEEATCSICLDYFTDPVMTACGHNFCRECIQMSWEKGKVKKGKKKQKGSFPCPECREMSPQRNLRPNRLLTKVAEMA

RQHPGLQKRDLCQAHQEPLKLFCQDDQSPICVVCREAQEHRMHRVLPLDEAAREYK LKLEEDIKYLREEMMKTETLQAKEEQTLTEWQ ERVKERRERI

LEEFQKVVLFLVEEERRILQVLKKEEEDTLGKLQDSKASLDHQSRSLDLILLQLEERSQQEPLQMLQ DVKDTLNR RRASACSTQRWSSPRLSRPCAEF

QDR 
Transcript ENSMUST00000075141
Sequence
TCTTCCCTAGTGCTGTAGCACAAACCCAGCCTTTCCCCCATGCGGCGCACTTGCCCCTGGCACCTGGCGCAGTGCAAGGCTCCTTCCTT GAGCCATGGA

TGCGGTGGAGCTTGCCAGACGGTTACAAGAGGAGGCCACATGTTCCATCTGCCTTGACTACTTTACTGATCCTGTGATGACTGCCTGTGGCCACAACTTC

TGCAGAGAGTGCATCCAGATGAGCTGGGAGAAGGGGAAGGTCAAGAAAGGGAAGAAGAAGCAGAAGGGCTCCTTCCCCTGCCCCGAGTGCAGGGAGATGT

CCCCTCAGAGGAACCTGAGGCCCAACCGCCTCCTGACAAAAGTGGCTGAGATGGCCCGCCAGCACCCTGGGCTGCAGAAGCGAGACCTGTGCCAAGCACA

CCAAGAACCCCTTAAGCTGTTCTGCCAGGATGACCAGAGCCCCATTTGTGTGGTCTGCAGGGAGGCCCAGGAGCACCGGATGCACAGGGTGCTGCCTCTG

GATGAGGCTGCAAGGGAGTATAAG CTCAAGTTGGAGGAGGACATAAAATATCTACGGGAGGAGATGATGAAGACGGAGACACTGCAAGCCAAGGAGGAA

CAGACCTTAACTGAGTGGCAG GAGAGAGTGAAAGAGCGGAGAGAACGCATCCTGGAGGAGTTTCAGAAGGTGGTCTTGTTTCTGGTGGAAGAAGAACGG

AGGATCCTCCAGGTCCTGAAGAAGGAGGAAGAGGACACCTTAGGGAAGCTGCAGGACAGCAAGGCCTCCCTGGACCACCAAAGCCGCTCCCTGGACCTGA

TCCTGTTGCAGCTGGAGGAGCGGAGCCAGCAGGAGCCCCTCCAGATGCTGCAG GATGTGAAGGACACCTTGAACAG GAAGGAGAGCTTCAGCGTGCAG

TACCCAGAGGTGGTCCTCCCCGCGGCTATCAAGACCTTGTGCAGAGTTCCAGGACAGATAGAGGTGCTCAAAAGCTTCCAAG AGGATGTGATGCCGGAC

CCCAGCTCAGCATACCCCTATCTCCTCCTCTACGAGAGTCGCCAGAGGCGGTACTTGAGCCCACCGCCCGAGGGCAGCGCCCCCTACAGCAAGGACCGGT

TCGTGGCCTACCCGTGCGCTGTGGGGCAGAAGAGCTTTTCCTCTGGAAGGCACTACTGGGAAGTGGGCATGAATCTCACCGGGGATGCACTCTGGGCCTT

GGGGGTGTGCAGGGACAACGTGAGTCGGAAGGACAGAGTGCTTAAGTCCCCAGAAAACGGCTTCTGGGTAGTGCAGCTGTCCAAGGGGAAAAAACAGCTG

TCCCTGTTACCCAATTCCACTCTAGTCACTCTCACAGAGCCTCCCAGCCACATGGGGATCTTCCTGGACTTCCAGGCTGGAGAGGTGTCCTTCTACAGCG

TGAACGATGGGTCCCACTTACACAGCTTTTCCCAGGCTGCCTTCCCTGGGCCGCTGCTGCCATTCTTCTGCTTGGGGGCTCCCAAGTCAGGCCAGATGGT

CATCTCCACAGTGACCATGTGGGTGAAGGGATAGAGGCTTGAAGCCGGGCAGACACTGGGTGTGCCACAGTTCCCCAGAAGGCAGGGTGCTTCACCACCG

TGGCCACCTACCCAGGCTTCCCTGGGGCACTAAGAGTTAATACCTGTGCTGGCAGGGTAACTGAAATACAGTCAAGATTCAAATGC
Translation
 MDAVELARRLQEEATCSICLDYFTDPVMTACGHNFCRECIQMSWEKGKVKKGKKKQKGSFPCPECREMSPQRNLRPNRLLTKVAEMARQHPGLQKRDLC

QAHQEPLKLFCQDDQSPICVVCREAQEHRMHRVLPLDEAAREYK LKLEEDIKYLREEMMKTETLQAKEEQTLTEWQ ERVKERRERILEEFQKVVLFLV

EEERRILQVLKKEEEDTLGKLQDSKASLDHQSRSLDLILLQLEERSQQEPLQMLQ DVKDTLNR RKESFSVQYPEVVLPAAIKTLCRVPGQIEVLKSFQ

E EDVMPDPSSAYPYLLLYESRQRRYLSPPPEGSAPYSKDRFVAYPCAVGQKSFSSGRHYWEVGMNLTGDALWALGVCRDNVSRKDRVLKSPENGFWVVQ

LSKGKKQLSLLPNSTLVTLTEPPSHMGIFLDFQAGEVSFYSVNDGSHLHSFSQAAFPGPLLPFFCLGAPKSGQMVISTVTMWVKG

For any suggestions or comments, please send an email to unitrap@crg.es