Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036985 (Zdhhc9)
Chromosomal location
Chr X: 45525146 - 45562055 (-)
Description
zinc finger, DHHC domain containing 9 Gene [Source:MGI (curated);Acc:Zdhhc9-002]
RefSeq_dna
NM_172465 
RefSeq_peptide
NP_766053.1 
UniGene
Mm.408095 
MGI
MGI:2444393 
Uniprot/SWISSPROT
P59268 
Uniprot/SPTREMBL
B1AVD4 
Human Ortholog
ENSG00000188706 (ZDHHC9)
Omim not available
UniTrap UNI29976
Vector Insertion
Chr X: 45559844 - 45561861
Public Clones D170G09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37180
Vector Insertion
Chr X: 45547898 - 45559844
Public Clones CMHD-GT_482H8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088935
Sequence
GGTGCTCAGACCCCAGAGAGAAGCTGGCTGGAGCTTGGCAG - UNI29976 - GGCTCTTGATAATGTTTGACCCAGTGGCAACACTAGTAGACGACC

TGATTTTAAAGCTGACCTCAGCCTCTGCATCTTCTCTCGAGTAGTCCCAAAGCCCATCTTGGACCAGGAACTGTAATCATGTCTGTGATGGTGGTAAGAA

AGAAGGTGACACGGAAATGGGAGAAACTCCCAGGCAGGAACACCTTCTGCTGTGATGGCCGCGTCATGATGGCCCGGCAAAAGGGCATCTTCTACCTGAC

CCTCTTCCTCATCCTGGGGACATGTACACTCTTCTTTGCCTTCGA - UNI29976 - - UNI37180 - GTGTCGCTACCTGGCTGTTCAGCTGTCT

CCTGCCATTCCTGTGTTTGCCGCTATGCTCTTTCTTTTCTCCATGGCCACGCTGTTGAGGACAAGTTTCAGTGACCCTGGAGTGATTCCTCGAGCACTAC

CAGATGAAGCAGCTTTCATAGAAATGGAAATAG AAGCCACCAATGGTGCCGTGCCACAGGGCCAGCGACCACCTCCTCGTATTAAGAATTTCCAGATAA

ACAACCAGATTGTGAAACTGAAATACTGTTATACATGCAAGATCTTCCGGCCTCCCAGGGCCTCCCATTGTAGCATCTGTGACAACTGTGTGG AGCGCT

TCGACCATCACTGCCCCTGGGTGGGAAACTGTGTTGGAAAGAGGAACTACCGCTACTTCTACCTCTTCATCCTCTCTCTCTCCCTCCTCACAATTTATGT

CTTCGCCTTTAACATCGTCTATGTGGCCCTCA AATCCTTGAAAATTGGCTTCCTGGAGACACTGAAAGAAACGCCTGGAAC TGTTCTGGAAGTACTCA

TTTGCTTCTTCACTCTCTGGTCTGTTGTGGGGCTGACTGGATTTCACACATTCCTTGTGGCTCTCAATCAGACCACCAATGAAGAC ATCAAAGGATCAT

GGACAGGGAAGAATCGTGTGCAGAATCCGTACAGCCACGGCAACATTGTGAAGAACTGCTGTGAAGTGCTTTGTGGCCCCTTGCCCCCCAG TGTCCTGG

ATCGAAGGGGTATTTTGCCACTGGAGGAAAGTGGAAGTCGACCTCCAAGTACTCAAGAGACCAGCAGTAGCCTGTTGCCACAGAGCCCA GCCTCCACAG

AGCATATGAACTCTAATGAGATGGCAGAGGACACCAGCATTCCTGAAGAGATGCCACCTCCAGAACCCCCAGAGCCACCACAGGAGGCATCCGAAGCTGA

GAAGTAGCCTCTCTATGGAAGAGACTTTTGTTTGTGTTTCATTAGGGCTATGAGAGATTTCAGGGGAGACAACCACCTGAGACAGAGAACAAATGAGCTG

TCCCTTATTACTATTTTTCTTTGGTCTTTAGTCACCCAATTACCGGCATCTTCTTGCTGCAAACTTTTTTTTTTTAATGTTTGAACTTAAGACAGTGGCA

GAAGATGCCAGTCACATCTGGCAACTGGACAAATGGGTCTCTTGGGACATGGCACTGGTTGGTTTCCCATTGTCTCAGCCACAAGGTATCCTTGGACTCC

CCTCCTCTTCCCTCCAGATCCTAGCTCCCCTGCTGGGGGTCATTGGTCTCTTTCTGGGGCTAAAGAGTCTCAAGACTGACTCCAGTCCTTTCCAGCTGCT

GCATGTCCCGAGTCCAGAGGCAGTCACAGAGACCTCTGGCCAGGGAATTCTAACTGGGCTCTTGACTCCTTCAGAACTAAGGATTGGAGAGGGACGCTGG

AGGATTCTCCTGGCTCCAAAGTGCCAGCATTGCCAGCCAATCCTTTTAGGAATAGGGCAGGTACCTTCCACTTGTATTTATTTCTGTAGCTTCTCTTTTC

TCCCCCCCCATCTACTCTCTAACATCCAAATCCCACTCTTTCCCCCATTAGATGCTATACGTAAGTAGTCATGGTAGAGATAATACATTTCTCCTACGTT

CTCCAGAAACTTCAATGCCTGTGCTATTCTCAATAAGCATTGATGAGATGCCAACAACACAGCCCCTCACACTCTCTGTCTCATCTCCCCTCTTTGCTCA

TGAGTCCACTTTCATTTTCTCCTTTTGACTCCTGCTTCAGCCGGGAGCAGGACTAGCAGTAATAAAAGTCTGCACTTTGCTGGTTTCTTTTCCTCAGGGG

AAGCCTGAGTGCTCACTTAAACACTACCCCTCAGACTTCTTGTGTAAGGCCTACAGAGGCCGTGAATGCACAAATGGGGAAGCCAAGGCACAGAGAGGCT

CTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCTT

CTCCCCACCTCTCCCCTCCCCTCCCTCATCATCCCCTCAAAACAAAAGAGAGAGAAAAAAAAGACTAATCAGTACTTCCATTAAGCCTTGGCTGAGTGAG

GGAAAGCCCAGCACTGCTGCCCCACCCTCCGGGTATCCCGCTCCAAGGCCTCAGCCCACCTCTGGCAACGGTAACCACACCAGGGGCTTCATCTAAGCCC

CTGCTCTTCCAGCACTTCCACCGGCAGAGTCCCAGAGCCACTTGATCCTGGGGGTGGACTGCAGCCCCCCAGGCAGCTCTGCTCGGGACCTGCACTATTT

CAGGGAAGAAGAACTATGTATTATATGTGGCTATATTTCCTAGAGCACCTGTGTTTTTCTCTTTCTAAGCCAGGGTCTTGTCTGGATGACTTACGGGGAC

AGGGAGGGGTGCAAACCACGACTTTTAATCTATTTGAAGGCGATTAAACTGTGTCTAATGCAA
Translation
 - UNI29976 - MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFE - UNI29976 - - UNI37180 - ECR

YLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIE EATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCS

ICDNCVE ERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALK KSLKIGFLETLKETPGT TVLEVLICFFTLWSVVGLTGFHTFLV

ALNQTTNED IKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPS SVLDRRGILPLEESGSRPPSTQETSSSLLPQSP ASTEHMNSNEMAEDTSIPEE

MPPPEPPEPPQEASEAEK
Transcript ENSMUST00000037960
Sequence
GACGTGAGGAGCGTTCCATTCCGCCAGCGGTGGGCGGTTGCCACAGCTGGTTTAGGGCCCCGACTATTGGGGCCCCTTGTCAGGAGGAGGCACCCTCCCT

GTCAGGGAGAAGTCGCTACCACCTCTGGCTGCTGACGAGATCCCCCGGGACAGTGTGCACTTTCTGCCCCCAGTTGCCGGCCGAGTTCAGTGTCCCTTGT

TCAG - UNI29976 - GGCTCTTGATAATGTTTGACCCAGTGGCAACACTAGTAGACGACCTGATTTTAAAGCTGACCTCAGCCTCTGCATCTTCTCT

CGAGTAGTCCCAAAGCCCATCTTGGACCAGGAACTGTAATCATGTCTGTGATGGTGGTAAGAAAGAAGGTGACACGGAAATGGGAGAAACTCCCAGGCAG

GAACACCTTCTGCTGTGATGGCCGCGTCATGATGGCCCGGCAAAAGGGCATCTTCTACCTGACCCTCTTCCTCATCCTGGGGACATGTACACTCTTCTTT

GCCTTCGA - UNI29976 - - UNI37180 - GTGTCGCTACCTGGCTGTTCAGCTGTCTCCTGCCATTCCTGTGTTTGCCGCTATGCTCTTTCTTT

TCTCCATGGCCACGCTGTTGAGGACAAGTTTCAGTGACCCTGGAGTGATTCCTCGAGCACTACCAGATGAAGCAGCTTTCATAGAAATGGAAATAG AAG

CCACCAATGGTGCCGTGCCACAGGGCCAGCGACCACCTCCTCGTATTAAGAATTTCCAGATAAACAACCAGATTGTGAAACTGAAATACTGTTATACATG

CAAGATCTTCCGGCCTCCCAGGGCCTCCCATTGTAGCATCTGTGACAACTGTGTGG AGCGCTTCGACCATCACTGCCCCTGGGTGGGAAACTGTGTTGG

AAAGAGGAACTACCGCTACTTCTACCTCTTCATCCTCTCTCTCTCCCTCCTCACAATTTATGTCTTCGCCTTTAACATCGTCTATGTGGCCCTCA AATC

CTTGAAAATTGGCTTCCTGGAGACACTGAAAGAAACGCCTGGAAC TGTTCTGGAAGTACTCATTTGCTTCTTCACTCTCTGGTCTGTTGTGGGGCTGAC

TGGATTTCACACATTCCTTGTGGCTCTCAATCAGACCACCAATGAAGAC ATCAAAGGATCATGGACAGGGAAGAATCGTGTGCAGAATCCGTACAGCCA

CGGCAACATTGTGAAGAACTGCTGTGAAGTGCTTTGTGGCCCCTTGCCCCCCAG TGTCCTGGATCGAAGGGGTATTTTGCCACTGGAGGAAAGTGGAAG

TCGACCTCCAAGTACTCAAGAGACCAGCAGTAGCCTGTTGCCACAGAGCCCA GCCTCCACAGAGCATATGAACTCTAATGAGATGGCAGAGGACACCAG

CATTCCTGAAGAGATGCCACCTCCAGAACCCCCAGAGCCACCACAGGAGGCATCCGAAGCTGAGAAGTAGCCTCTCTATGGAAGAGACTTTTGTTTGTGT

TTCATTAGGGCTATGAGAGATTTCAGGGGAGACAACCACCTGAGACAGAGAACAAATGAGCTGTCCCTTATTACTATTTTTCTTTGGTCTTTAGTCACCC

AATTACCGGCATCTTCTTGCTGCAAACTTTTTTTTTTTAATGTTTGAACTTAAGACAGTGGCAGAAGATGCCAGTCACATCTGGCAACTGGACAAATGGG

TCTCTTGGGACATGGCACTGGTTGGTTTCCCATTGTCTCAGCCACAAGGTATCCTTGGACTCCCCTCCTCTTCCCTCCAGATCCTAGCTCCCCTGCTGGG

GGTCATTGGTCTCTTTCTGGGGCTAAAGAGTCTCAAGACTGACTCCAGTCCTTTCCAGCTGCTGCATGTCCCGAGTCCAGAGGCAGTCACAGAGACCTCT

GGCCAGGGAATTCTAACTGGGCTCTTGACTCCTTCAGAACTAAGGATTGGAGAGGGACGCTGGAGGATTCTCCTGGCTCCAAAGTGCCAGCATTGCCAGC

CAATCCTTTTAGGAATAGGGCAGGTACCTTCCACTTGTATTTATTTCTGTAGCTTCTCTTTTCTCCCCCCCCATCTACTCTCTAACATCCAAATCCCACT

CTTTCCCCCATTAGATGCTATACGTAAGTAGTCATGGTAGAGATAATACATTTCTCCTACGTTCTCCAGAAACTTCAATGCCTGTGCTATTCTCAATAAG

CATTGATGAGATGCCAACAACACAGCCCCTCACACTCTCTGTCTCATCTCCCCTCTTTGCTCATGAGTCCACTTTCATTTTCTCCTTTTGACTCCTGCTT

CAGCCGGGAGCAGGACTAGCAGTAATAAAAGTCTGCACTTTGCTGGTTTCTTTTCCTCAGGGGAAGCCTGAGTGCTCACTTAAACACTACCCCTCAGACT

TCTTGTGTAAGGCCTACAGAGGCCGTGAATGCACAAATGGGGAAGCCAAGGCACAGAGAGGCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCT

CCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCTTCTCCCCACCTCTCCCCTCCCCTCCCTCATCATCCCCT

CAAAACAAAAGAGAGAGAAAAAAAAGACTAATCAGTACTTCCATTAAGCCTTGGCTGAGTGAGGGAAAGCCCAGCACTGCTGCCCCACCCTCCGGGTATC

CCGCTCCAAGGCCTCAGCCCACCTCTGGCAACGGTAACCACACCAGGGGCTTCATCTAAGCCCCTGCTCTTCCAGCACTTCCACCGGCAGAGTCCCAGAG

CCACTTGATCCTGGGGGTGGACTGCAGCCCCCCAGGCAGCTCTGCTCGGGACCTGCACTATTTCAGGGAAGAAGAACTATGTATTATATGTGGCTATATT

TCCTAGAGCACCTGTGTTTTTCTCTTTCTAAGCCAGGGTCTTGTCTGGATGACTTACGGGGACAGGGAGGGGTGCAAACCACGACTTTTAATCTATTTGA

AGGCGATTAAACTGTGTCTAATGC
Translation
 - UNI29976 - MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFE - UNI29976 - - UNI37180 - ECR

YLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIE EATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCS

ICDNCVE ERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALK KSLKIGFLETLKETPGT TVLEVLICFFTLWSVVGLTGFHTFLV

ALNQTTNED IKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPS SVLDRRGILPLEESGSRPPSTQETSSSLLPQSP ASTEHMNSNEMAEDTSIPEE

MPPPEPPEPPQEASEAEK

For any suggestions or comments, please send an email to unitrap@crg.es