Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036986 (Pml)
Chromosomal location
Chr 9: 58066349 - 58097593 (-)
Description
promyelocytic leukemia Gene [Source:MGI Symbol;Acc:MGI:104662]
RefSeq_dna
NM_178087 
RefSeq_peptide
NP_032910.3 NP_835188.2 
UniGene
Mm.392123 
MGI
MGI:104662 
Uniprot/SWISSPROT
Q60953 
Uniprot/SPTREMBL
O89066 Q8BSJ6 
Human Ortholog
ENSG00000140464 (PML)
Omim not available
UniTrap UNI10340
Vector Insertion
Chr 9: 58095246 - 58097347
Public Clones (sanger) XA129 (baygenomics) E061A07 (ggtc) 5SE285C04 (ggtc) D159C05 (ggtc)
PST25865-NR (escells) IST12571G4 (tigm) IST12873G12 (tigm) IST14138B7 (tigm)
IST11507D1 (tigm) IST10325G1 (tigm) IST10806A9 (tigm) IST10031C1 (tigm)
IST11692F3 (tigm) IST13051H2 (tigm) IST10921E6 (tigm) IST10763E6 (tigm)
Private Clones OST219894 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7564
Vector Insertion
Chr 9: 58082741 - 58094781
Public Clones (sanger) RRR308 (baygenomics) E042E08 (ggtc) D155D07 (ggtc) E044B06 (ggtc)
E038F06 (ggtc) E027F05 (ggtc) D144G06 (ggtc) CMHD-GT_341D1-3 (cmhd) IST10875A9 (tigm)
IST10073A3 (tigm) IST10272G6 (tigm) IST14856H4 (tigm) IST12673D10 (tigm)
IST12001A10 (tigm) IST14692D7 (tigm) IST11668H6 (tigm)
Private Clones OST269696 (lexicon) OST260032 (lexicon) OST226014 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24495
Vector Insertion
Chr 9: 58081055 - 58082159
Public Clones not available
Private Clones OST218039 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37484
Vector Insertion
Chr 9: 58078297 - 58081055
Public Clones PST19070-NR (escells) PST17065-NR (escells) PST18336-NR (escells) PST17882-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21481
Vector Insertion
Chr 9: 58077894 - 58078297
Public Clones not available
Private Clones OST329173 (lexicon) OST37931 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34186
Vector Insertion
Chr 9: 58077161 - 58077894
Public Clones IST11392G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2427
Vector Insertion
Chr 9: 58069673 - 58077161
Public Clones AC0295 (sanger) PST19333-NL (escells) PST23285-NR (escells) PST10188-NL (escells)
PST23212-NR (escells) PST24617-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041209
Sequence
CCTCTCGGGAGGCGGGCTCTCCTCGGGCAATCTCTCGCTCAGTTTTCTGGCTCAGATCTGAGACCCATTTCCCGCCTTCACAGACCTAATCAAGAAATGG

AAACTGAACCAGTTTCCGTGCAGAAGGTACCTGCACCCCCTGGATCTCCCTGTCGACAACAGGACTCTGCCCTGACCCCCACGCCCACCATGCCTCCCCC

AGAGGAACCCTCCGAAGACTATGAACACAGCCAAAGCCCTGCAGAG - UNI10340 - CAAGCCATACAGGAGGAATTTCAGTTTCTGCGCTGCCCGA

GCTGCCAGGCCCAAGCCAAGTGCCCCAAACTGCTGCCTTGCCTGCACACGCTGTGCTCCGGATGCCTGGAGGCGCCTGGCCTGCAGTGCCCCATCTGCAA

GGCTCCTGGGCAGGCCGATGCTAATGGGGAGGCCCTGGATAACGTGTTCTTCGAGAGCCTGCAGCGGCGCCTGGCGGTGTTCCGGCAGATCGTGGATGCT

CAGGCTGCGTGCACCCGCTGCAAAGGCTTGGCCGACTTCTGGTGTTTCGAGTGTGAACAGCTCATTTGCAGCAAGTGCTTCGAAGCACACCAGTGGTACC

TCAAGCATGAGGCCCGGCCCCTGGCTGATCTCCGCGACAATTCAGTGAGCAGCTTCCTCGACAGTACGCGCAAGTCCAATATCTTCTGCTCCAATACCAA

CCACCGCAACCCTGCGCTGACTGA - UNI7564 - CATCTACTGCCGAGGCTGCGCCAAGCCTCTGTGTTGCACATGCGCGCTCCTGGACCGCAACCA

CAGCCATCTCCATTGCGATATTGGTGAGGAGATTCAGCAGTGGCATGAGGAACTAGGCACCATGACACAGACTCTGGAGGAGCAGGGCAGAACCTTCGAC

AGTGCCCATGCACAGATGTGCTCAGCTATAGGACAGCTGGACCACGCACGCGCAGACATTGAGAAGCAGATCCGCGCACGCGTGCGCCAGGTGGTAGACT

ACGTGCAGGCTCAGGAGCGCGAGCTGCTCGAGGCGGTGAATGACCGCTACCAGCGCGACTACCAGGAAATAGCTGGCCAGCTGAGCTGCCTGGAAGCTGT

GCTGCAGCGCATCCGCACTAGTGGGGCGCTGGTCAAGAGGATGAAGCTCTATGCCTCCGACCAGGAGGTGCTGGATATGCACAGCTTTCTGCGCAAGGCA

CTCTGTAGCTTGCGCCAGGAGGAGCCCCAGAACCAGAAAGTCCAGCTGCTCACCAGAGGTTTCGAGGAGTTCAAGCTGTGCCTGCAGGACTTCATCTCCT

GCATCACCCAGAGGATAA - UNI24495 - - UNI37484 - ATGCAGCTGTAGCCAGCCCAGAGGCAGCCAGCAATCAACCAGAGGCAGCCAGCAC

TCACCCAGTGACAACCAGCACGCCTGAGGACCTTGAGCAG - UNI21481 - - UNI34186 - - UNI37484 - GAGGCTTCTCAGACAGTCGG

CTCCATGAAGAGGAAGTGCTCCCACGAAGATTGCTCCAGGAAGATCATCAAGATGGAGTCCACAGAGGAGAACGAGGACAGGTTGGCCACAAGCTCCCCC

GAGCAGTCCTGGCCCAGCACTTTCAAGGCCACCTCCCCTCCCCATCTGGATGGGACTTCCAACCCTGAGAGCACCGTCCCTGAAAAAAAGATCCTCCTGC

CCAACAACAATCATGTTACCAGTGACACAGGGGAAACAG - UNI34186 - AGGAGCGAGTTGTGGTGATCAGCAGCTCAGAGGATTCGGACACCGAG

AATCTG - UNI2427 - - UNI34186 - TCCTCCCACGAGTTGGACGATAGCAGCAGTGAGTCCAGCAGCCTGCAGCTGGAGGGCCCCAATTCCCT

CAAGGCCTTGGATGAGAGCCTCGCCGAACCCCACTTAGAAGACAGGACCCTGGTTTTCTTTGACCTCAAGATTGACAATGAAA CCCAGAAAATTAGCCA

GCTGGCCGCGGTGAACCGGGAAAGCAAGTTCCGTGTGCTCATCCAGCCCGAGGCCTTCAGTGTCTACTCCAAAGCTGTCTCCCTGGAGGCGGGGCTCCGG

CACTTCCTCAGCTTCCTCACCACCATGCACCGTCCCATCTTGGCGTGTTCTAGGCTGTGGGGGCCGGGACTCCCCATCTTCTTCCAGACCCTGAGTGATA

TTAACAAGCTGTGGGAATTCCAGGACACCATCTCAGGTTTCTTGGCCGTGCTGCCCCTCATCCGGGAACGCATACCCGGCGCTAGCAGCTTCAAACTTGG

GAACCTAGCCAAGACCTACCTGGCGAGAAACATGAGCGAACGCAGCGCTCTGGCTTCTGTGCTGGCCATGAGGGACTTGTGCTGCCTCCTTGAGATCTCC

CCAGGACTGCCGCTGGCCCAGCATATCTACTCCTTTAGTAGCTTGCAGTGTTTTGCTTCCCTGCAGCCCCTAATTCAGGCCAGCGTCCTGCCACAGTCCG

AGGCCCGCCTCTTGGCCCTCCACAATGTGAGCTTTGTAGAGTTACTGAATGCATATCGCACCAACAGGCAAGAAGGCTTGAAGAAGTATGTCCACTATCT

GAGCCTGCAGACCACCCCGTTGTCATCGTCGGCTTCCACCCAAGTTGCCCAATTCCTGCAGGCTCTTAGCACCCACATGGAAGGACTGTTGGAAGGCCAT

GCCCCTGCTGGGGCAGAAGGCAAAGCTGAAAGTAAGGGATGCCTGGCCTAGCGGCTCGGCACAGAGGGAGGGGCATCCCTGAGCTAATCCCCACCCTCCA

GTACATTCCTAGGTCCTGGTCATTTAGTTCAGAACAGGTGTCCTTTCTCTGTGACCAAACTTACTTTCTCTAAAATTCCTGCAGCAGACACCAGAGGCAC

CCCAGACCTAGACCTCCCTTCTAAAAGCCAGAACCAGGAAGGCTTGCATAAAGAAGGTGTGGCCTCTGAGCTCTCAAGGGCCCCAGTTGCCACCAACCAC

CACCACAGGTGGCCTTATGGCTCTTCCTGGATGTTCGATTCATGTAAGTGACCTACCTGCTGATGATCCACAAATAATACTTTAGGGTGGCACTGACCGC

TATACCAGCAGCCCCATGAGCACTCAAAGTGCCTTTCGAACCATAATGCCATCTTGAATTTGGGTCCTCTCGGCCCCAACTGACCAGAGGCCAACTGTGT

TCACATTTATTTTTCTTAAAGTACTTTTGTTCCAAAGGGGCCTTGTGGCGCCAGAGAGCTAGGAACTGTGGCTCCGTCCATACCCGTTTCCACACACTGA

CCCTTCAGAGTTGGTTCTTTGTTTATCAGGCCTCCTGACCCTCCCTGCACTTAGCCCTTCCAAGGGACATCCAGTGGAGCACTGGCATCTCGAGCTTGGG

AAGGTCTTTAGAATTAGGCTCTCTGGAGCAGGGCCTGTAGTGTTAACAAGTTCTCTGGGTGGTTCTATTCTGAGCACCCCTGTTGCCTCTGACGACCCCC

CCCCCACCAAAGGGAAGCAGAGAAGCCCCTGGCCATGCACATTGAGTATGATGAGCAAAAGGCCAGAACTCCAGTGTCCTGTGAGATTGGCTGACCCGAG

CGAGGTATTATCTCGGTCTTCAGCCGCTGGAGTTTCAGGGCTGGGCAGCAGGTTACTGGAGAGGCAGGCAAGAAGCGTCCTTACCTTCTCTCATTCCCCA

GCTCTCATTCTGAGCCTTTGGTCCCTGACCTTATGGCCATCTTGGAGGTCAGTTGTTCCCTGTGGTTGACTGAACTGCTGTTGCTGTCCACATTCCACCC

TGACCCATTCCCTGCTTGCGCCTAGGGTGTTTTCCAGATAGCCCAGAGTTCCAGCTTTGACAGCCTGATGACCTCCATTTTCATATGAATGATGCCTGCA

CCCCCACACCTCTGACTCATCCTATGGGTGTTCCAAGGCACCCAATGCTCCACCCTTTAATACAGTTTCTTATGGTTGTTGTGACCCCCAACCATAAAAT

CATTTTGTTGCT
Translation
MPPPEEPSEDYEHSQSPAE - UNI10340 - QAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCLEAPGLQCPICKAPGQADANGEALDNVFFESL

QRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDSTRKSNIFCSNTNHRNPALTD - UNI7564 -

 DIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERELLE

AVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRIN - U

NI24495 - - UNI37484 - NAAVASPEAASNQPEAASTHPVTTSTPEDLEQ - UNI21481 - - UNI34186 - - UNI37484 - EASQT

VGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETE - UNI34186 - EERV

VVISSSEDSDTENL - UNI2427 - - UNI34186 - SSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNET TQKISQLA

AVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNL

AKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSL

QTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA
Transcript ENSMUST00000114136
Sequence
CCTCTCGGGAGGCGGGCTCTCCTCGGGCAATCTCTCGCTCAGTTTTCTGGCTCAGATCTGAGACCCATTTCCCGCCTTCACAGACCTAATCAAGAAATGG

AAACTGAACCAGTTTCCGTGCAGAAGGTACCTGCACCCCCTGGATCTCCCTGTCGACAACAGGACTCTGCCCTGACCCCCACGCCCACCATGCCTCCCCC

AGAGGAACCCTCCGAAGACTATGAACACAGCCAAAGCCCTGCAGAG - UNI10340 - CAAGCCATACAGGAGGAATTTCAGTTTCTGCGCTGCCCGA

GCTGCCAGGCCCAAGCCAAGTGCCCCAAACTGCTGCCTTGCCTGCACACGCTGTGCTCCGGATGCCTGGAGGCGCCTGGCCTGCAGTGCCCCATCTGCAA

GGCTCCTGGGCAGGCCGATGCTAATGGGGAGGCCCTGGATAACGTGTTCTTCGAGAGCCTGCAGCGGCGCCTGGCGGTGTTCCGGCAGATCGTGGATGCT

CAGGCTGCGTGCACCCGCTGCAAAGGCTTGGCCGACTTCTGGTGTTTCGAGTGTGAACAGCTCATTTGCAGCAAGTGCTTCGAAGCACACCAGTGGTACC

TCAAGCATGAGGCCCGGCCCCTGGCTGATCTCCGCGACAATTCAGTGAGCAGCTTCCTCGACAGTACGCGCAAGTCCAATATCTTCTGCTCCAATACCAA

CCACCGCAACCCTGCGCTGACTGA - UNI7564 - CATCTACTGCCGAGGCTGCGCCAAGCCTCTGTGTTGCACATGCGCGCTCCTGGACCGCAACCA

CAGCCATCTCCATTGCGATATTGGTGAGGAGATTCAGCAGTGGCATGAGGAACTAGGCACCATGACACAGACTCTGGAGGAGCAGGGCAGAACCTTCGAC

AGTGCCCATGCACAGATGTGCTCAGCTATAGGACAGCTGGACCACGCACGCGCAGACATTGAGAAGCAGATCCGCGCACGCGTGCGCCAGGTGGTAGACT

ACGTGCAGGCTCAGGAGCGCGAGCTGCTCGAGGCGGTGAATGACCGCTACCAGCGCGACTACCAGGAAATAGCTGGCCAGCTGAGCTGCCTGGAAGCTGT

GCTGCAGCGCATCCGCACTAGTGGGGCGCTGGTCAAGAGGATGAAGCTCTATGCCTCCGACCAGGAGGTGCTGGATATGCACAGCTTTCTGCGCAAGGCA

CTCTGTAGCTTGCGCCAGGAGGAGCCCCAGAACCAGAAAGTCCAGCTGCTCACCAGAGGTTTCGAGGAGTTCAAGCTGTGCCTGCAGGACTTCATCTCCT

GCATCACCCAGAGGATAA - UNI24495 - - UNI37484 - ATGCAGCTGTAGCCAGCCCAGAGGCAGCCAGCAATCAACCAGAGGCAGCCAGCAC

TCACCCAGTGACAACCAGCACGCCTGAGGACCTTGAGCAG - UNI21481 - - UNI34186 - - UNI37484 - GAGGCTTCTCAGACAGTCGG

CTCCATGAAGAGGAAGTGCTCCCACGAAGATTGCTCCAGGAAGATCATCAAGATGGAGTCCACAGAGGAGAACGAGGACAGGTTGGCCACAAGCTCCCCC

GAGCAGTCCTGGCCCAGCACTTTCAAGGCCACCTCCCCTCCCCATCTGGATGGGACTTCCAACCCTGAGAGCACCGTCCCTGAAAAAAAGATCCTCCTGC

CCAACAACAATCATGTTACCAGTGACACAGGGGAAACAG - UNI34186 - AGGAGCGAGTTGTGGTGATCAGCAGCTCAGAGGATTCGGACACCGAG

AATCTG - UNI2427 - - UNI34186 - TCCTCCCACGAGTTGGACGATAGCAGCAGTGAGTCCAGCAGCCTGCAGCTGGAGGGCCCCAATTCCCT

CAAGGCCTTGGATGAGAGCCTCGCCGAACCCCACTTAGAAGACAGGACCCTGGTTTTCTTTGACCTCAAGATTGACAATGAAA CCCAGAAAATTAGCCA

GCTGGCCGCGGTGAACCGGGAAAGCAAGTTCCGTGTGCTCATCCAGCCCGAGGCCTTCAGTGTCTACTCCAAAGCTGTCTCCCTGGAGGCGGGGCTCCGG

CACTTCCTCAGCTTCCTCACCACCATGCACCGTCCCATCTTGGCGTGTTCTAGGCTGTGGGGGCCGGGACTCCCCATCTTCTTCCAGACCCTGAGTGATA

TTAACAAGCTGTGGGAATTCCAGGACACCATCTCAGGTTTCTTGGCCGTGCTGCCCCTCATCCGGGAACGCATACCCGGCGCTAGCAGCTTCAAACTTGG

GAACCTAGCCAAGACCTACCTGGCGAGAAACATGAGCGAACGCAGCGCTCTGGCTTCTGTGCTGGCCATGAGGGACTTGTGCTGCCTCCTTGAGATCTCC

CCAGGACTGCCGCTGGCCCAGCATATCTACTCCTTTAGTAGCTTGCAGTGTTTTGCTTCCCTGCAGCCCCTAATTCAGGCCAGCGTCCTGCCACAGTCCG

AGGCCCGCCTCTTGGCCCTCCACAATGTGAGCTTTGTAGAGTTACTGAATGCATATCGCACCAACAGGCAAGAAGGCTTGAAGAAGTATGTCCACTATCT

GAGCCTGCAGACCACCCCGTTGTCATCGTCGGCTTCCACCCAAGTTGCCCAATTCCTGCAGGCTCTTAGCACCCACATGGAAGGACTGTTGGAAGGCCAT

GCCCCTGCTGGGGCAGAAGGCAAAGCTGAAAGTAAGGGATGCCTGGCCTAGCGGCTCGGCACAGAGGGAGGGGCATCCCTGAGCTAATCCCCACCCTCCA

GTACATTCCTAGGTCCTGGTCATTTAGTTCAGAACAGGTGTCCTTTCTCTGTGACCAAACTTACTTTCTCTAAAATTCCTGCAGCAGACACCAGAGGCAC

CCCAGACCTAGACCTCCCTTCTAAAAGCCAGAACCAGGAAGGCTTGCATAAAGAAGGTGTGGCCTCTGAGCTCTCAAGGGCCCCAGTTGCCACCAACCAC

CACCACAGGTGGCCTTATGGCTCTTCCTGGATGTTCGATTCATGTAAGTGACCTACCTGCTGATGATCCACAAATAATACTTTAGGGTGGCACTGACCGC

TATACCAGCAGCCCCATGAGCACTCAAAGTGCCTTTCGAACCATAATGCCATCTTGAATTTGGGTCCTCTCGGCCCCAACTGACCAGAGGCCAACTGTGT

TCACATTTATTTTTCTTAAAGTACTTTTGTTCCAAAGGGGCCTTGTGGCGCCAGAGAGCTAGGAACTGTGGCTCCGTCCATACCCGTTTCCACACACTGA

CCCTTCAGAGTTGGTTCTTTGTTTATCAGGCCTCCTGACCCTCCCTGCACTTAGCCCTTCCAAGGGACATCCAGTGGAGCACTGGCATCTCGAGCTTGGG

AAGGTCTTTAGAATTAGGCTCTCTGGAGCAGGGCCTGTAGTGTTAACAAGTTCTCTGGGTGGTTCTATTCTGAGCACCCCTGTTGCCTCTGACGACCCCC

CCCCCACCAAAGGGAAGCAGAGAAGCCCCTGGCCATGCACATTGAGTATGATGAGCAAAAGGCCAGAACTCCAGTGTCCTGTGAGATTGGCTGACCCGAG

CGAGGTATTATCTCGGTCTTCAGCCGCTGGAGTTTCAGGGCTGGGCAGCAGGTTACTGGAGAGGCAGGCAAGAAGCGTCCTTACCTTCTCTCATTCCCCA

GCTCTCATTCTGAGCCTTTGGTCCCTGACCTTATGGCCATCTTGGAGGTCAGTTGTTCCCTGTGGTTGACTGAACTGCTGTTGCTGTCCACATTCCACCC

TGACCCATTCCCTGCTTGCGCCTAGGGTGTTTTCCAGATAGCCCAGAGTTCCAGCTTTGACAGCCTGATGACCTCCATTTTCATATGAATGATGCCTGCA

CCCCCACACCTCTGACTCATCCTATGGGTGTTCCAAGGCACCCAATGCTCCACCCTTTAATACAGTTTCTTATGGTTGTTGTGACCCCCAACCATAAAAT

CATTTTGTTGCT
Translation
METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAE - UNI10340 - QAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCL

EAPGLQCPICKAPGQADANGEALDNVFFESLQRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDST

RKSNIFCSNTNHRNPALTD - UNI7564 - DIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQL

DHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQK

VQLLTRGFEEFKLCLQDFISCITQRIN - UNI24495 - - UNI37484 - NAAVASPEAASNQPEAASTHPVTTSTPEDLEQ - UNI21481 - 

- UNI34186 - - UNI37484 - EASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLP

NNNHVTSDTGETE - UNI34186 - EERVVVISSSEDSDTENL - UNI2427 - - UNI34186 - SSHELDDSSSESSSLQLEGPNSLKALDES

LAEPHLEDRTLVFFDLKIDNET TQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLW

EFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLL

ALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA
Transcript ENSMUST00000085673
Sequence
CCTCTCGGGAGGCGGGCTCTCCTCGGGCAATCTCTCGCTCAGTTTTCTGGCTCAGATCTGAGACCCATTTCCCGCCTTCACAGACCTAATCAAGAAATGG

AAACTGAACCAGTTTCCGTGCAGAAGGTACCTGCACCCCCTGGATCTCCCTGTCGACAACAGGACTCTGCCCTGACCCCCACGCCCACCATGCCTCCCCC

AGAGGAACCCTCCGAAGACTATGAACACAGCCAAAGCCCTGCAGAG - UNI10340 - CAAGCCATACAGGAGGAATTTCAGTTTCTGCGCTGCCCGA

GCTGCCAGGCCCAAGCCAAGTGCCCCAAACTGCTGCCTTGCCTGCACACGCTGTGCTCCGGATGCCTGGAGGCGCCTGGCCTGCAGTGCCCCATCTGCAA

GGCTCCTGGGCAGGCCGATGCTAATGGGGAGGCCCTGGATAACGTGTTCTTCGAGAGCCTGCAGCGGCGCCTGGCGGTGTTCCGGCAGATCGTGGATGCT

CAGGCTGCGTGCACCCGCTGCAAAGGCTTGGCCGACTTCTGGTGTTTCGAGTGTGAACAGCTCATTTGCAGCAAGTGCTTCGAAGCACACCAGTGGTACC

TCAAGCATGAGGCCCGGCCCCTGGCTGATCTCCGCGACAATTCAGTGAGCAGCTTCCTCGACAGTACGCGCAAGTCCAATATCTTCTGCTCCAATACCAA

CCACCGCAACCCTGCGCTGACTGA - UNI7564 - CATCTACTGCCGAGGCTGCGCCAAGCCTCTGTGTTGCACATGCGCGCTCCTGGACCGCAACCA

CAGCCATCTCCATTGCGATATTGGTGAGGAGATTCAGCAGTGGCATGAGGAACTAGGCACCATGACACAGACTCTGGAGGAGCAGGGCAGAACCTTCGAC

AGTGCCCATGCACAGATGTGCTCAGCTATAGGACAGCTGGACCACGCACGCGCAGACATTGAGAAGCAGATCCGCGCACGCGTGCGCCAGGTGGTAGACT

ACGTGCAGGCTCAGGAGCGCGAGCTGCTCGAGGCGGTGAATGACCGCTACCAGCGCGACTACCAGGAAATAGCTGGCCAGCTGAGCTGCCTGGAAGCTGT

GCTGCAGCGCATCCGCACTAGTGGGGCGCTGGTCAAGAGGATGAAGCTCTATGCCTCCGACCAGGAGGTGCTGGATATGCACAGCTTTCTGCGCAAGGCA

CTCTGTAGCTTGCGCCAGGAGGAGCCCCAGAACCAGAAAGTCCAGCTGCTCACCAGAGGTTTCGAGGAGTTCAAGCTGTGCCTGCAGGACTTCATCTCCT

GCATCACCCAGAGGATAA - UNI24495 - - UNI37484 - ATGCAGCTGTAGCCAGCCCAGAGGCAGCCAGCAATCAACCAGAGGCAGCCAGCAC

TCACCCAGTGACAACCAGCACGCCTGAGGACCTTGAGCAG - UNI37484 - CCCAAAGAAGTGCAGAGTGTACAGGCTCAGGCCCTAGAGCTGTCTA

AGACCCAACCTGTGGCTATGGTAAAAACAGTGCCTGGAGCACACCCTGTACCAGTGTATGCCTTTTCAATGCAAGGCCCCACCTACAGAGAG - UNI21

481 - - UNI34186 - - UNI37484 - GAGGCTTCTCAGACAGTCGGCTCCATGAAGAGGAAGTGCTCCCACGAAGATTGCTCCAGGAAGATCAT

CAAGATGGAGTCCACAGAGGAGAACGAGGACAGGTTGGCCACAAGCTCCCCCGAGCAGTCCTGGCCCAGCACTTTCAAGGCCACCTCCCCTCCCCATCTG

GATGGGACTTCCAACCCTGAGAGCACCGTCCCTGAAAAAAAGATCCTCCTGCCCAACAACAATCATGTTACCAGTGACACAGGGGAAACAG - UNI341

86 - AGGAGCGAGTTGTGGTGATCAGCAGCTCAGAGGATTCGGACACCGAGAATCTG - UNI2427 - - UNI34186 - TCCTCCCACGAGTTGG

ACGATAGCAGCAGTGAGTCCAGCAGCCTGCAGCTGGAGGGCCCCAATTCCCTCAAGGCCTTGGATGAGAGCCTCGCCGAACCCCACTTAGAAGACAGGAC

CCTGGTTTTCTTTGACCTCAAGATTGACAATGAAA CCCAGAAAATTAGCCAGCTGGCCGCGGTGAACCGGGAAAGCAAGTTCCGTGTGCTCATCCAGCC

CGAGGCCTTCAGTGTCTACTCCAAAGCTGTCTCCCTGGAGGCGGGGCTCCGGCACTTCCTCAGCTTCCTCACCACCATGCACCGTCCCATCTTGGCGTGT

TCTAGGCTGTGGGGGCCGGGACTCCCCATCTTCTTCCAGACCCTGAGTGATATTAACAAGCTGTGGGAATTCCAGGACACCATCTCAGGTTTCTTGGCCG

TGCTGCCCCTCATCCGGGAACGCATACCCGGCGCTAGCAGCTTCAAACTTGGGAACCTAGCCAAGACCTACCTGGCGAGAAACATGAGCGAACGCAGCGC

TCTGGCTTCTGTGCTGGCCATGAGGGACTTGTGCTGCCTCCTTGAGATCTCCCCAGGACTGCCGCTGGCCCAGCATATCTACTCCTTTAGTAGCTTGCAG

TGTTTTGCTTCCCTGCAGCCCCTAATTCAGGCCAGCGTCCTGCCACAGTCCGAGGCCCGCCTCTTGGCCCTCCACAATGTGAGCTTTGTAGAGTTACTGA

ATGCATATCGCACCAACAGGCAAGAAGGCTTGAAGAAGTATGTCCACTATCTGAGCCTGCAGACCACCCCGTTGTCATCGTCGGCTTCCACCCAAGTTGC

CCAATTCCTGCAGGCTCTTAGCACCCACATGGAAGGACTGTTGGAAGGCCATGCCCCTGCTGGGGCAGAAGGCAAAGCTGAAAGTAAGGGATGCCTGGCC

TAGCGGCTCGGCACAGAGGGAGGGGCATCCCTGAGCTAATCCCCACCCTCCAGTACATTCCTAGGTCCTGGTCATTTAGTTCAGAACAGGTGTCCTTTCT

CTGTGACCAAACTTACTTTCTCTAAAATTCCTGCAGCAGACACCAGAGGCACCCCAGACCTAGACCTCCCTTCTAAAAGCCAGAACCAGGAAGGCTTGCA

TAAAGAAGGTGTGGCCTCTGAGCTCTCAAGGGCCCCAGTTGCCACCAACCACCACCACAGGTGGCCTTATGGCTCTTCCTGGATGTTCGATTCATGTAAG

TGACCTACCTGCTGATGATCCACAAATAATACTTTAGGGTGGCACTGACCGCTATACCAGCAGCCCCATGAGCACTCAAAGTGCCTTTCGAACCATAATG

CCATCTTGAATTTGGGTCCTCTCGGCCCCAACTGACCAGAGGCCAACTGTGTTCACATTTATTTTTCTTAAAGTACTTTTGTTCCAAAGGGGCCTTGTGG

CGCCAGAGAGCTAGGAACTGTGGCTCCGTCCATACCCGTTTCCACACACTGACCCTTCAGAGTTGGTTCTTTGTTTATCAGGCCTCCTGACCCTCCCTGC

ACTTAGCCCTTCCAAGGGACATCCAGTGGAGCACTGGCATCTCGAGCTTGGGAAGGTCTTTAGAATTAGGCTCTCTGGAGCAGGGCCTGTAGTGTTAACA

AGTTCTCTGGGTGGTTCTATTCTGAGCACCCCTGTTGCCTCTGACGACCCCCCCCCCACCAAAGGGAAGCAGAGAAGCCCCTGGCCATGCACATTGAGTA

TGATGAGCAAAAGGCCAGAACTCCAGTGTCCTGTGAGATTGGCTGACCCGAGCGAGGTATTATCTCGGTCTTCAGCCGCTGGAGTTTCAGGGCTGGGCAG

CAGGTTACTGGAGAGGCAGGCAAGAAGCGTCCTTACCTTCTCTCATTCCCCAGCTCTCATTCTGAGCCTTTGGTCCCTGACCTTATGGCCATCTTGGAGG

TCAGTTGTTCCCTGTGGTTGACTGAACTGCTGTTGCTGTCCACATTCCACCCTGACCCATTCCCTGCTTGCGCCTAGGGTGTTTTCCAGATAGCCCAGAG

TTCCAGCTTTGACAGCCTGATGACCTCCATTTTCATATGAATGATGCCTGCACCCCCACACCTCTGACTCATCCTATGGGTGTTCCAAGGCACCCAATGC

TCCACCCTTTAATACAGTTTCTTATGGTTGTTGTGACCCCCAACCATAAAATCATTTTGTTGCT
Translation
METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAE - UNI10340 - QAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCL

EAPGLQCPICKAPGQADANGEALDNVFFESLQRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDST

RKSNIFCSNTNHRNPALTD - UNI7564 - DIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQL

DHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQK

VQLLTRGFEEFKLCLQDFISCITQRIN - UNI24495 - - UNI37484 - NAAVASPEAASNQPEAASTHPVTTSTPEDLEQ - UNI37484 - 

PKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYRE - UNI21481 - - UNI34186 - - UNI37484 - EASQTVGSMKRKCS

HEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETE - UNI34186 - EERVVVISSSEDS

DTENL - UNI2427 - - UNI34186 - SSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNET TQKISQLAAVNRESKFR

VLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNM

SERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSA

STQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA

For any suggestions or comments, please send an email to unitrap@crg.es