Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037005 (Xpnpep2)
Chromosomal location
Chr X: 45461902 - 45489845 (+)
Description
X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound Gene [Source:MGI (curated);Acc:Xpnpep2-003]
RefSeq_dna
NM_133213 
RefSeq_peptide
NP_573476.2 
UniGene
Mm.129279 
MGI
MGI:2180001 
Uniprot/SPTREMBL
Q8BU59 B1AVD1 Q3TA51 Q3TPA9 Q8BVD6 Q91Y31 Q91ZH9 B1AVD2 
Human Ortholog
ENSG00000122121 (XPNPEP2)
Omim not available
UniTrap UNI26460
Vector Insertion
Chr X: 45462095 - 45462372
Public Clones not available
Private Clones OST116638 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114998
Sequence
ACAAGAAACCAGCACAGGTTGCTTGGGCAGCCCGAGGCACACTCTCCACGGTGGCTTCCCAGACTTCCTGAAACAAAAGATTACAGAAGGATCCTCATCT

AACATCGAGACACAGCCATCAACCTTATTTGCTTCTGCCCAGGAAAGGCCTGGAAGAAGAGGCCACCAAACAACCCAACCCTCTCTCCAGTCCCTTGATC

TACTCGTCGCCTGCATCTGGAGACCCAATGGCCCAAGCCTACTGGCAGTGCTACCCCTGGCTTGTTCTCCTCTGTG - UNI26460 - CATGTGCCTG

GAGCTACCCAGAGCCCAAGTACCTTGGAAGGGAAGATGTGAGAAACTGTTCAACCAGCCCTGAG CGCCTGCCAGTTACTGCCGTCAATACAACAATGCG

GCTTGCAGCCCTCCGCCAACAGATGGAGACCTGGAATCTCTCTGCCTACATCATCCCAGACACGGATGCACACATG AGTGAGTACATTGGCAAACCTGA

TAAGAGGCGAGAGTGGATTTCAGGCTTCACAGGGTCTGCAG GTACTGCTGTGGTGACCATGGGGAAAGCAGCTGTCTGGACCGATAGTCGTTACTGGAC

TCAGGCCGAAAGGCAGATGGACTGCAACTGGGAGCTGCACAAGGAAG TTAGCATTTCTTCCATTGTCGCCTGGATCTTAGCTGAAGTCCCTGATGGACA

GAACGTGGGCTTCGACCCCTTCCTCTTTTCTGTTG ATTCCTGGAAAAATTATGATCAAGGATTCCAAGACTCCAGCAGACACCTGTTATCGGTTACAAC

CAACCTTGTTGACGTGGCATGGGGGTCAGAGAGGCCCCCAGTGCCAAGCCAACCCATTTATGCCCTGCCGAAAGAATTTACAG GGAGCACTTGGCAGGA

AAAAGTATCCGCTGTCCGAAGCTATATGGAGCACCATGCCAAGACTCCAACTGGGGTCCTTCTATCTGCACTTGATGAGACAGCCT GGCTCTTCAACCT

TCGTAGCAGTGACATCCCCTATAACCCCTTCTTCTACTCCTATGCACTGCTCACGAACTCCTCCATCAG GTTGTTTGTCAACAAGAGTCGCTTTAGCCT

TGAGACCTTGCAGTACCTGAATACAAACTGCACATTACCCATGTGTGTGCAACTTGAGGACTACAGTCAAGTTCGTGACAGTGTGAAGGCCTATGCCTCA

GGCGATGTGAAAATCTTAATTGGGGTCAGCTATACCACCTATGGGGTCTATGAAGTGATACCCAAG GAGAAACTCGTGACAGACACCTACTCCCCAGTG

ATGTTAATCAAGGCTGTGAAGAACAGCAAGGAGCAGGCCCTTTTGAAGAGCAGCCAC GTGCGGGACGCTGTGGCTGTGATCCAGTACTTGGTCTGGTTG

GAGAAGAACGTGCCCAAAGGCACGGTGGATGAGTTTTCTGGGGCAGAATACATTGATGAGTTACGACG GAATGAAAACTTCTCCTCTGGACCCAGTTTT

GAAACCATCTCTGCTAGTGGCCTGAATGCCGCCCTGGCCCATTACAG CCCAACAAAAGAGCTGCACCGTAAGCTGTCCTCAGATGAGATGTACCTGGTG

GATTCTGGGGGGCAATACTG GGATGGGACCACAGATATCACCAGAACAGTACATTGGGGCACTCCTACTGCCTTCCAAAAG GAGGCCTATACTCGAGT

GCTAATGGGAAACATCGATCTGTCCAGACTTGTCTTTCCTGCTGCTACATCAG GGAGAGTGATAGAAGCCTTTGCCCGAAGAGCCTTATGGGAAGTTGG

GCTCAATTATGGTCATGGGACAGGCCATGGCATTGGCAACTTCCTCTGTGTGCATGAGT GGCCAGTGGGATTCCAGTATAACAACATTGCCATGGCCAA

GGGCATGTTCACTTCCATTG AACCTGGATACTACCATGATGGGGAGTTTGGAATCCGTCTTGAAGATGTCGCCCTTGTGGTAGAAGCAAAAACCAAG A

TGGACTGAAATTTCATGGTGAAGCTTCATGGCCTACAAGAAAACCTATATAAACTCACTTATAATCCCAAGTGGAAAAGGACCTTTCAAGAAAAGACCCA

GAAGCGATGAAGAAAAGGGCTCAAAACTAAATTGAATAGAAAATGTCTGTATAGTCAGCTATTGGATGGAACACAGGCCCCTATTGGAGGAGCTAGAGAA

AGTACCCAAGGAGTTAAAGGGGTCTGCAACCCTATAGGTGGAACAACAATATGAACTAACCAGTCACCCCCGGAGCTTGTGTCTCTAGCTGCATATGTAG

CAGAAGATGGCCTAGTCGGCCATCGATGGGAAGAGAGACCCCTTGGTCTTGCAAACTTATATGCCTCAGTACAGGGGAATGCCAGGGCCAAGAAGTGGGA

GTGGGTGGGTAGGGGAGTGGAGGAGGGAGGGTATGGGAAAAAAAAAGAAAAAGAAAATGTCTGTATAAAAATCATATCATAGCCAAAATCAAAAGATGTT

TCAAGGGCTGGAGAGATGGCTCAGTGATTGAGAGCACTGCTCTTCCAGAGGTCCTGAGTTCAATTCCCAGTAACCACATGGTGGCTCACAACCATCTGTA

ATGGGATCTTATGCCCTCTTCTGATGTGTCTGAAGACAAGAACAGTGTACTCACATATATAAAATAAACAAATCTTTAGAAACAAAACAACAACAAAACA

AAAGGTTGTTTCAAGTTAAGTGCAACAAAGAAAAAATTAATATTCTTAATTTACTGTAAAGATCAAAAGCTATAAGATCAAAACTGGGAGAAATGAGCAA

AAGACATGAAGAGACAGTTAGATAAAATGAACAATAATTTGACACATGTGAAAAAATGCTCAACAACATTCTTAAACATGTATAAATCAAAACATATCAT

TCCCCTGGGTTTAGCACTATGTAAAAGTAGTAGAGGAAGGTACAGAGAAATGTGTATGGTAGTATCCACTTTGTGTGACTTTTTAAAACGTGTATATGTA

TGTGTATGTGTATATACAGTTACCAGATTAGTAAAACTTAAAGACTTTG
Translation
MAQAYWQCYPWLVLLCA - UNI26460 - ACAWSYPEPKYLGREDVRNCSTSPE RLPVTAVNTTMRLAALRQQMETWNLSAYIIPDTDAHM SEYIG

KPDKRREWISGFTGSAG GTAVVTMGKAAVWTDSRYWTQAERQMDCNWELHKEV VSISSIVAWILAEVPDGQNVGFDPFLFSVD DSWKNYDQGFQDSS

RHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTG GSTWQEKVSAVRSYMEHHAKTPTGVLLSALDETAW WLFNLRSSDIPYNPFFYSYALLTNSSI

R RLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPK EKLVTDTYSPVMLIKAVKNSKEQALLKSSH 

VRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRR RNENFSSGPSFETISASGLNAALAHYS SPTKELHRKLSSDEMYLVDSGGQYW WDGTTDIT

RTVHWGTPTAFQK EAYTRVLMGNIDLSRLVFPAATSG GRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEW WPVGFQYNNIAMAKGMFTSIE EP

GYYHDGEFGIRLEDVALVVEAKTK MD
Transcript ENSMUST00000077775
Sequence
ACCAGTGCCTGATGTGAGCTAATAGGAAACAGCTTGCTGGAGGGTGGGGAACAGAATTCAGAAACTGCTAGGGTAGAGCTGCTGAAGAGGGGGGCTGGGA

GAGGCTGGGTGATTGAGACCAGCTGTTGCTCGTCCATCTCAGAGATCTTTGGACTCTGCCCAGGGGCAGGCTCACACCCTACCTACCCTAAGCCACAAGA

AACCAGCACAGGTTGCTTGGGCAGCCCGAGGCACACTCTCCACGGTGGCTTCCCAGACTTCCTGAAACAAAAGATTACAGAAGGATCCTCATCTAACATC

GAGACACAGCCATCAACCTTATTTGCTTCTGCCCAGGAAAGGCCTGGAAGAAGAGGCCACCAAACAACCCAACCCTCTCTCCAGTCCCTTGATCTACTCG

TCGCCTGCATCTGGAGACCCAATGGCCCAAGCCTACTGGCAGTGCTACCCCTGGCTTGTTCTCCTCTGTG - UNI26460 - CATGTGCCTGGAGCTA

CCCAGAGCCCAAGTACCTTGGAAGGGAAGATGTGAGAAACTGTTCAACCAGCCCTGAG CGCCTGCCAGTTACTGCCGTCAATACAACAATGCGGCTTGC

AGCCCTCCGCCAACAGATGGAGACCTGGAATCTCTCTGCCTACATCATCCCAGACACGGATGCACACATG AGTGAGTACATTGGCAAACCTGATAAGAG

GCGAGAGTGGATTTCAGGCTTCACAGGGTCTGCAG GTACTGCTGTGGTGACCATGGGGAAAGCAGCTGTCTGGACCGATAGTCGTTACTGGACTCAGGC

CGAAAGGCAGATGGACTGCAACTGGGAGCTGCACAAGGAAG TTAGCATTTCTTCCATTGTCGCCTGGATCTTAGCTGAAGTCCCTGATGGACAGAACGT

GGGCTTCGACCCCTTCCTCTTTTCTGTTG ATTCCTGGAAAAATTATGATCAAGGATTCCAAGACTCCAGCAGACACCTGTTATCGGTTACAACCAACCT

TGTTGACGTGGCATGGGGGTCAGAGAGGCCCCCAGTGCCAAGCCAACCCATTTATGCCCTGCCGAAAGAATTTACAG GGAGCACTTGGCAGGAAAAAGT

ATCCGCTGTCCGAAGCTATATGGAGCACCATGCCAAGACTCCAACTGGGGTCCTTCTATCTGCACTTGATGAGACAGCCT GGCTCTTCAACCTTCGTAG

CAGTGACATCCCCTATAACCCCTTCTTCTACTCCTATGCACTGCTCACGAACTCCTCCATCAG GTTGTTTGTCAACAAGAGTCGCTTTAGCCTTGAGAC

CTTGCAGTACCTGAATACAAACTGCACATTACCCATGTGTGTGCAACTTGAGGACTACAGTCAAGTTCGTGACAGTGTGAAGGCCTATGCCTCAGGCGAT

GTGAAAATCTTAATTGGGGTCAGCTATACCACCTATGGGGTCTATGAAGTGATACCCAAG GAGAAACTCGTGACAGACACCTACTCCCCAGTGATGTTA

ATCAAGGCTGTGAAGAACAGCAAGGAGCAGGCCCTTTTGAAGAGCAGCCAC GTGCGGGACGCTGTGGCTGTGATCCAGTACTTGGTCTGGTTGGAGAAG

AACGTGCCCAAAGGCACGGTGGATGAGTTTTCTGGGGCAGAATACATTGATGAGTTACGACG GAATGAAAACTTCTCCTCTGGACCCAGTTTTGAAACC

ATCTCTGCTAGTGGCCTGAATGCCGCCCTGGCCCATTACAG CCCAACAAAAGAGCTGCACCGTAAGCTGTCCTCAGATGAGATGTACCTGGTGGATTCT

GGGGGGCAATACTG GGATGGGACCACAGATATCACCAGAACAGTACATTGGGGCACTCCTACTGCCTTCCAAAAG GAGGCCTATACTCGAGTGCTAAT

GGGAAACATCGATCTGTCCAGACTTGTCTTTCCTGCTGCTACATCAG GGAGAGTGATAGAAGCCTTTGCCCGAAGAGCCTTATGGGAAGTTGGGCTCAA

TTATGGTCATGGGACAGGCCATGGCATTGGCAACTTCCTCTGTGTGCATGAGT GGCCAGTGGGATTCCAGTATAACAACATTGCCATGGCCAAGGGCAT

GTTCACTTCCATTG AACCTGGATACTACCATGATGGGGAGTTTGGAATCCGTCTTGAAGATGTCGCCCTTGTGGTAGAAGCAAAAACCAAG TACCCAG

GGGACTACCTGACTTTTGAATTGGTGTCCTTTGTGCCCTATGACCGAAACCTCATCGATGTCAGGCTGCTGTCCCCAGAGCAG CTCCAGTACCTGAACC

GCTACTATCAGACCATTCGTGAGAATGTAGGCCCAGAGCTGCAGCGTCGCCAGCTGCTGGAGGAGTTTGCATGGTTGGAGCAGCACACGGAGCCCCTGTC

AGCCAGGGCCCCTCATATCATCTCCTGGACCTCTCTGTGGGTGGCCTCTGCCCTTGCCATCCTCAGCTGGAGTAGCTAGAGGCCCCTGATTCTCCTGTGG

ACTGTTCACTTGTGTCTGGGGATTCATTTGCTTCTGCTCAGCTGTCCTCTCCCTATGCCATACATGTCCCAAGGGCTACTGATGGCTCACCACCTTGAAG

CCACTGGCCAGATCCCAGACAGTATGTTCTACCTTCTCCCAGATGTACATACTTTATCATGAACTCCCACCCCTGGGCCCTGGGATATCAGAGCCTGCTA

CAGTGAGTCCCTCTCTCCCAAAGTAAAGGACCCTATAGGGCAACACCCAGAGGGCTCCATCCTATCCCCACCTGCTGGAGAAGGCCAGAGCTTTTGCCAC

CCACACTGACTCCAGACTTTTAAAAGGTGCCTCTGGCCACTCTTACCCACAGGCCTACAGTAGCCTGTCTGCTGTATTTGGAGAAGAAAGCTACTGGGTA

GTCTGGTCTCAAACTCCCATTTGTAGTATTGGGGAGAACAGATAAGTTGAAGTCAGCTGTGGCCTGGAACTGAACACCTCAGTCAATAATGTGTACCTAC

CTCTCCCCATCTGTGAACCCGCAGCTTCTAAACTACCGCTGTGCCCCTTAACAATGACCACATTGGGAGTGAAGGCTCAGGATTTAGACTATGGAATGGA

GGGAATGGCAAGGTGCTCTGGCTATCCCAGGCTCCCCTGGTGCTTGGAGCAGTTTAATCTTCTAAGGTAGAGCCGCCATGGCAGTGCTATTAAAGCCTCT

CATATCTTTGAAAACCTC
Translation
MAQAYWQCYPWLVLLCA - UNI26460 - ACAWSYPEPKYLGREDVRNCSTSPE RLPVTAVNTTMRLAALRQQMETWNLSAYIIPDTDAHM SEYIG

KPDKRREWISGFTGSAG GTAVVTMGKAAVWTDSRYWTQAERQMDCNWELHKEV VSISSIVAWILAEVPDGQNVGFDPFLFSVD DSWKNYDQGFQDSS

RHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTG GSTWQEKVSAVRSYMEHHAKTPTGVLLSALDETAW WLFNLRSSDIPYNPFFYSYALLTNSSI

R RLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPK EKLVTDTYSPVMLIKAVKNSKEQALLKSSH 

VRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRR RNENFSSGPSFETISASGLNAALAHYS SPTKELHRKLSSDEMYLVDSGGQYW WDGTTDIT

RTVHWGTPTAFQK EAYTRVLMGNIDLSRLVFPAATSG GRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEW WPVGFQYNNIAMAKGMFTSIE EP

GYYHDGEFGIRLEDVALVVEAKTK YPGDYLTFELVSFVPYDRNLIDVRLLSPEQ LQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLSARAPH

IISWTSLWVASALAILSWSS
Transcript ENSMUST00000115000
Sequence
ACCAGTGCCTGATGTGAGCTAATAGGAAACAGCTTGCTGGAGGGTGGGGAACAGAATTCAGAAACTGCTAGGGTAGAGCTGCTGAAGAGGGGGGCTGGGA

GAGGCTGGGTGATTGAGACCAGCTGTTGCTCGTCCATCTCAGAGATCTTTGGACTCTGCCCAGGGGCAGGCTCACACCCTACCTACCCTAAGCCACAAGA

AACCAGCACAGGTTGCTTGGGCAGCCCGAGGCACACTCTCCACGGTGGCTTCCCAGACTTCCTGAAACAAAAGATTACAGAAGGATCCTCATCTAACATC

GAGACACAGCCATCAACCTTATTTGCTTCTGCCCAGGAAAGGCCTGGAAGAAGAGGCCACCAAACAACCCAACCCTCTCTCCAGTCCCTTGATCTACTCG

TCGCCTGCATCTGGAGACCCAATGGCCCAAGCCTACTGGCAGTGCTACCCCTGGCTTGTTCTCCTCTGTG - UNI26460 - CATGTGCCTGGAGCTA

CCCAGAGCCCAAGTACCTTGGAAGGGAAGATGTGAGAAACTGTTCAACCAGCCCTGAG CGCCTGCCAGTTACTGCCGTCAATACAACAATGCGGCTTGC

AGCCCTCCGCCAACAGATGGAGACCTGGAATCTCTCTGCCTACATCATCCCAGACACGGATGCACACATG AGTGAGTACATTGGCAAACCTGATAAGAG

GCGAGAGTGGATTTCAGGCTTCACAGGGTCTGCAG GTACTGCTGTGGTGACCATGGGGAAAGCAGCTGTCTGGACCGATAGTCGTTACTGGACTCAGGC

CGAAAGGCAGATGGACTGCAACTGGGAGCTGCACAAGGAAG TTAGCATTTCTTCCATTGTCGCCTGGATCTTAGCTGAAGTCCCTGATGGACAGAACGT

GGGCTTCGACCCCTTCCTCTTTTCTGTTG ATTCCTGGAAAAATTATGATCAAGGATTCCAAGACTCCAGCAGACACCTGTTATCGGTTACAACCAACCT

TGTTGACGTGGCATGGGGGTCAGAGAGGCCCCCAGTGCCAAGCCAACCCATTTATGCCCTGCCGAAAGAATTTACAG GGAGCACTTGGCAGGAAAAAGT

ATCCGCTGTCCGAAGCTATATGGAGCACCATGCCAAGACTCCAACTGGGGTCCTTCTATCTGCACTTGATGAGACAGCCTGTGAGTGGGGATTTTTGAAC

ATGGGTCAGTCTGGTAGTCCCAAGCTTCCTGGACCTTGCAACATACAGCTTTTCCTAAAACAACAACATATTCACCAGCTCCTACGAGCTCCCAAGATCA

TAGTCTGTGGAAACTCAGAGGGGAAGAGAGCAGCTGTTTGGGGCTATAGAACAAGGAAGCCAGGGAGCTCCAAGCAAGTGG GGCTCTTCAACCTTCGTA

GCAGTGACATCCCCTATAACCCCTTCTTCTACTCCTATGCACTGCTCACGAACTCCTCCATCAG GTTGTTTGTCAACAAGAGTCGCTTTAGCCTTGAGA

CCTTGCAGTACCTGAATACAAACTGCACATTACCCATGTGTGTGCAACTTGAGGACTACAGTCAAGTTCGTGACAGTGTGAAGGCCTATGCCTCAGGCGA

TGTGAAAATCTTAATTGGGGTCAGCTATACCACCTATGGGGTCTATGAAGTGATACCCAAG GAGAAACTCGTGACAGACACCTACTCCCCAGTGATGTT

AATCAAGGCTGTGAAGAACAGCAAGGAGCAGGCCCTTTTGAAGAGCAGCCAC GTGCGGGACGCTGTGGCTGTGATCCAGTACTTGGTCTGGTTGGAGAA

GAACGTGCCCAAAGGCACGGTGGATGAGTTTTCTGGGGCAGAATACATTGATGAGTTACGACG GAATGAAAACTTCTCCTCTGGACCCAGTTTTGAAAC

CATCTCTGCTAGTGGCCTGAATGCCGCCCTGGCCCATTACAG CCCAACAAAAGAGCTGCACCGTAAGCTGTCCTCAGATGAGATGTACCTGGTGGATTC

TGGGGGGCAATACTG GGATGGGACCACAGATATCACCAGAACAGTACATTGGGGCACTCCTACTGCCTTCCAAAAG GAGGCCTATACTCGAGTGCTAA

TGGGAAACATCGATCTGTCCAGACTTGTCTTTCCTGCTGCTACATCAG GGAGAGTGATAGAAGCCTTTGCCCGAAGAGCCTTATGGGAAGTTGGGCTCA

ATTATGGTCATGGGACAGGCCATGGCATTGGCAACTTCCTCTGTGTGCATGAGT GGCCAGTGGGATTCCAGTATAACAACATTGCCATGGCCAAGGGCA

TGTTCACTTCCATTG AACCTGGATACTACCATGATGGGGAGTTTGGAATCCGTCTTGAAGATGTCGCCCTTGTGGTAGAAGCAAAAACCAAG TACCCA

GGGGACTACCTGACTTTTGAATTGGTGTCCTTTGTGCCCTATGACCGAAACCTCATCGATGTCAGGCTGCTGTCCCCAGAGCAG CTCCAGTACCTGAAC

CGCTACTATCAGACCATTCGTGAGAATGTAGGCCCAGAGCTGCAGCGTCGCCAGCTGCTGGAGGAGTTTGCATGGTTGGAGCAGCACACGGAGCCCCTGT

CAGCCAGGGCCCCTCATATCATCTCCTGGACCTCTCTGTGGGTGGCCTCTGCCCTTGCCATCCTCAGCTGGAGTAGCTAGAGGCCCCTGATTCTCCTGTG

GACTGTTCACTTGTGTCTGGGGATTCATTTGCTTCTGCTCAGCTGTCCTCTCCCTATGCCATACATGTCCCAAGGGCTACTGATGGCTCACCACCTTGAA

GCCACTGGCCAGATCCCAGACAGTATGTTCTACCTTCTCCCAGATGTACATACTTTATCATGAACTCCCACCCCTGGGCCCTGGGATATCAGAGCCTGCT

ACAGTGAGTCCCTCTCTCCCAAAGTAAAGGACCCTATAGGGCAACACCCAGAGGGCTCCATCCTATCCCCACCTGCTGGAGAAGGCCAGAGCTTTTGCCA

CCCACACTGACTCCAGACTTTTAAAAGGTGCCTCTGGCCACTCTTACCCACAGGCCTACAGTAGCCTGTCTGCTGTATTTGGAGAAGAAAGCTACTGGGT

AGTCTGGTCTCAAACTCCCATTTGTAGTATTGGGGAGAACAGATAAGTTGAAGTCAGCTGTGGCCTGGAACTGAACACCTCAGTCAATAATGTGTACCTA

CCTCTCCCCATCTGTGAACCCGCAGCTTCTAAACTACCGCTGTGCCCCTTAACAATGACCACATTGGGAGTGAAGGCTCAGGATTTAGACTATGGAATGG

AGGGAATGGCAAGGTGCTCTGGCTATCCCAGGCTCCCCTGGTGCTTGGAGCAGTTTAATCTTCTAAGGTAGAGCCGCCATGGCAGTGCTATTAAAGCCTC

TCATATCTTTGAAAACCTC
Translation
MAQAYWQCYPWLVLLCA - UNI26460 - ACAWSYPEPKYLGREDVRNCSTSPE RLPVTAVNTTMRLAALRQQMETWNLSAYIIPDTDAHM SEYIG

KPDKRREWISGFTGSAG GTAVVTMGKAAVWTDSRYWTQAERQMDCNWELHKEV VSISSIVAWILAEVPDGQNVGFDPFLFSVD DSWKNYDQGFQDSS

RHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTG GSTWQEKVSAVRSYMEHHAKTPTGVLLSALDETACEWGFLNMGQSGSPKLPGPCNIQLFLKQQ

HIHQLLRAPKIIVCGNSEGKRAAVWGYRTRKPGSSKQVG GLFNLRSSDIPYNPFFYSYALLTNSSIR RLFVNKSRFSLETLQYLNTNCTLPMCVQLED

YSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPK EKLVTDTYSPVMLIKAVKNSKEQALLKSSH VRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYID

ELRR RNENFSSGPSFETISASGLNAALAHYS SPTKELHRKLSSDEMYLVDSGGQYW WDGTTDITRTVHWGTPTAFQK EAYTRVLMGNIDLSRLVFP

AATSG GRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEW WPVGFQYNNIAMAKGMFTSIE EPGYYHDGEFGIRLEDVALVVEAKTK YPGDYLTF

ELVSFVPYDRNLIDVRLLSPEQ LQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS

For any suggestions or comments, please send an email to unitrap@crg.es