Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037062 (Sh3glb1)
Chromosomal location
Chr 3: 144354032 - 144383110 (-)
Description
SH3-domain GRB2-like B1 (endophilin) Gene [Source:MGI Symbol;Acc:MGI:1859730]
RefSeq_dna
NM_019464 
RefSeq_peptide
NP_062337.1 
UniGene
Mm.271775 
MGI
MGI:1859730 
Uniprot/SWISSPROT
Q9JK48 
Uniprot/SPTREMBL
Q3TYR7 
Human Ortholog
ENSG00000097033 (SH3GLB1)
Omim not available
UniTrap UNI4623
Vector Insertion
Chr 3: 144364811 - 144368476
Public Clones AS0664 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7044
Vector Insertion
Chr 3: 144355093 - 144359817
Public Clones RRY115 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106210
Sequence
CGCCGTCGCCGTCGCCCGGCGCCCCAGCCCGGCCGCGGCGCTCCCCGCCTCCCCGCTAGCGCAGCCGGCGGCTCTGCCCGGCTGCCGCCCGGCATGAACA

TCATGGATTTCAACGTGAAGAAGCTGGCGGCCGACGCGGGCACCTTCCTCAGCCGGGCCGTGCAG TTCACAGAAGAAAAGCTTGGCCAGGCAGAGAAGA

CAGAACTGGACGCTCACCTGGAAAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAGATAATGAAGCAGACCGAAGTGCTGTTGCAGCC

AAATCCAA ATGCCAGGATAGAAGAATTTGTTTATGAGAAACTGGATAGAAAAGCACCAAGTCGTATAAACAACCCGGAACTTTTGGGACAATATATGAT

TGATGCAGGAACTGAGTTTGGCCCAGGGACAGCTTATG GAAATGCCCTTATTAAATGTGGAGAAACACAGAAGCGAATTGGAACAGCTGACCGAGAGCT

GATTCAAACATCAGCCTTAAATTTCCTCACTCCTTTAAGAAACTTTATAGAAGGGGATTACAAAACAATCGCA AAAGAAAGGAAACTATTACAGAATAA

GAGACTGGATTTGGATGCTGCAAAAACAAGACTAAAAAAGGCAAAAGCTGCAGAAACTAAAAGTTCA - UNI4623 - CAACTAAACTCCGCCCGCCC

TGAAGGAGATAACATTATG ATTTGGGCAGAGGAAGTGACAAAA TCTGAACAGGAATTGAGAATAACTCAAAGTGAATTTGATCGTCAGGCAGAGATTA

CCCGACTCCTGCTTGAGGGAATCAGCAGTACACAC GCCCATCATCTCCGCTGTCTGAATGACTTTGTAGAAGCCCAGATGACTTACTATGCACAGTGTT

ACCAGTATATGCTAGACCTACAGAAGCAACTGGGAAG - UNI7044 - TTTTCCATCCAATTATCTTTCTAACAACAATCAGACCTCTGGGACACCAG

TGCCATATGCTTTGTCAAATGCAATTGGTCCTTCTGCCCAGGCTTCAACGGGTAGCCTTGTAATCACCTGTCCTTCTAACCTCAATGACCTTAAAGAATC

CAGCAACAACAGGAAGGCTAGGGTCCTCTATGATTATGATGCTGCAAATAGCACTGAACTGTCACTCCTGGCCGATGAG GTAATCACTGTGTTCAGTGT

CGTTGGAATGGACTCCGACTGGCTAATGGGAGAGAGAGGAAATCAAAAGGGCAAGGTGCCAATTACCTACTTAGAACTTCTCAATTAAACAGGGAGACCA

CGAGAGGTTACCCATCACAACACCATATTTATATAAATAACTCTAAAGCAGGTTTAAATATCTTCCAATGTTAATGTCATAAGAGACTGAAAAAGAAAAA

TTATAAGCCATCAGAAACTGGCCATTCTGCCAATAAAACTGCATGGTTAATCCTTCATTACAGAATCTATGTTAGCGATTTCATGACAGGAGTGTTTTCT

TAAACAATTCTCTTTCTACTGAGGTTTTACTAACAAGCAACTTCTACTTTTGAGCCCCAACTTAAAAATGAAAGGATTCTTTTCTACTGAATTTTTCATT

AACAGGAAGCTTTTTCTTTTATGCAAAATAAATTTATTGTGCATG
Translation
MNIMDFNVKKLAADAGTFLSRAVQ FTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN NARIEEFVYEKLDRKAPSRINNPELL

GQYMIDAGTEFGPGTAYG GNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIA KERKLLQNKRLDLDAAKTRLKKAKAAETKSS - U

NI4623 - QLNSARPEGDNIM IWAEEVTK SEQELRITQSEFDRQAEITRLLLEGISSTH AHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGS - 

UNI7044 - SFPSNYLSNNNQTSGTPVPYALSNAIGPSAQASTGSLVITCPSNLNDLKESSNNRKARVLYDYDAANSTELSLLADE VITVFSVVGMDS

DWLMGERGNQKGKVPITYLELLN
Transcript ENSMUST00000074195
Sequence
CGCCGTCGCCGTCGCCCGGCGCCCCAGCCCGGCCGCGGCGCTCCCCGCCTCCCCGCTAGCGCAGCCGGCGGCTCTGCCCGGCTGCCGCCCGGCATGAACA

TCATGGATTTCAACGTGAAGAAGCTGGCGGCCGACGCGGGCACCTTCCTCAGCCGGGCCGTGCAG TTCACAGAAGAAAAGCTTGGCCAGGCAGAGAAGA

CAGAACTGGACGCTCACCTGGAAAACCTCCTTAGCAAAGCTGAATGTACCAAAATATGGACAGAAAAGATAATGAAGCAGACCGAAGTGCTGTTGCAGCC

AAATCCAA ATGCCAGGATAGAAGAATTTGTTTATGAGAAACTGGATAGAAAAGCACCAAGTCGTATAAACAACCCGGAACTTTTGGGACAATATATGAT

TGATGCAGGAACTGAGTTTGGCCCAGGGACAGCTTATG GAAATGCCCTTATTAAATGTGGAGAAACACAGAAGCGAATTGGAACAGCTGACCGAGAGCT

GATTCAAACATCAGCCTTAAATTTCCTCACTCCTTTAAGAAACTTTATAGAAGGGGATTACAAAACAATCGCA AAAGAAAGGAAACTATTACAGAATAA

GAGACTGGATTTGGATGCTGCAAAAACAAGACTAAAAAAGGCAAAAGCTGCAGAAACTAAAAGTTCA - UNI4623 - TCTGAACAGGAATTGAGAAT

AACTCAAAGTGAATTTGATCGTCAGGCAGAGATTACCCGACTCCTGCTTGAGGGAATCAGCAGTACACAC GCCCATCATCTCCGCTGTCTGAATGACTT

TGTAGAAGCCCAGATGACTTACTATGCACAGTGTTACCAGTATATGCTAGACCTACAGAAGCAACTGGGAAG - UNI7044 - TTTTCCATCCAATTA

TCTTTCTAACAACAATCAGACCTCTGGGACACCAGTGCCATATGCTTTGTCAAATGCAATTGGTCCTTCTGCCCAGGCTTCAACGGGTAGCCTTGTAATC

ACCTGTCCTTCTAACCTCAATGACCTTAAAGAATCCAGCAACAACAGGAAGGCTAGGGTCCTCTATGATTATGATGCTGCAAATAGCACTGAACTGTCAC

TCCTGGCCGATGAG GTAATCACTGTGTTCAGTGTCGTTGGAATGGACTCCGACTGGCTAATGGGAGAGAGAGGAAATCAAAAGGGCAAGGTGCCAATTA

CCTACTTAGAACTTCTCAATTAAACAGGGAGACCACGAGAGGTTACCCATCACAACACCATATTTATATAAATAACTCTAAAGCAGGTTTAAATATCTTC

CAATGTTAATGTCATAAGAGACTGAAAAAGAAAAATTATAAGCCATCAGAAACTGGCCATTCTGCCAATAAAACTGCATGGTTAATCCTTCATTACAGAA

TCTATGTTAGCGATTTCATGACAGGAGTGTTTTCTTAAACAATTCTCTTTCTACTGAGGTTTTACTAACAAGCAACTTCTACTTTTGAGCCCCAACTTAA

AAATGAAAGGATTCTTTTCTACTGAATTTTTCATTAACAGGAAGCTTTTTCTTTTATGCAAAATAAATTTATTGTGCATG
Translation
MNIMDFNVKKLAADAGTFLSRAVQ FTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPN NARIEEFVYEKLDRKAPSRINNPELL

GQYMIDAGTEFGPGTAYG GNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIA KERKLLQNKRLDLDAAKTRLKKAKAAETKSS - U

NI4623 - SEQELRITQSEFDRQAEITRLLLEGISSTH AHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGS - UNI7044 - SFPSNYLSNNNQT

SGTPVPYALSNAIGPSAQASTGSLVITCPSNLNDLKESSNNRKARVLYDYDAANSTELSLLADE VITVFSVVGMDSDWLMGERGNQKGKVPITYLELLN


For any suggestions or comments, please send an email to unitrap@crg.es