Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037098 (Rab11fip3)
Chromosomal location
Chr 17: 26125981 - 26206354 (-)
Description
RAB11 family interacting protein 3 (class II) Gene [Source:MGI (curated);Acc:Rab11fip3-001]
UniGene
Mm.41191 
MGI
MGI:2444431 
Uniprot/SPTREMBL
Q8JZT3 Q8CHD8 
Human Ortholog
ENSG00000090565 (RAB11FIP3)
Omim not available
UniTrap UNI29393
Vector Insertion
Chr 17: 26204526 - 26205807
Public Clones NAISTrap_18v3013 (NAISTrap)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7802
Vector Insertion
Chr 17: 26173628 - 26204526
Public Clones RRN286 (baygenomics) IST12155F2 (tigm) IST12155F1BBR1 (tigm) IST12161D4 (tigm)
IST12155E1BBR1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27988
Vector Insertion
Chr 17: 26173533 - 26173628
Public Clones not available
Private Clones OST42929 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3676
Vector Insertion
Chr 17: 26158806 - 26161319
Public Clones XT0193 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118828
Sequence
AGACGGGCACATGGATTTTACAGGAACACCAGCTTGGCTAACAAACAGGAAGGTGACAGTCAGTGACCTGGTGAGCAGGATCGCATGATGAGAAAGTCGA

CTGCAGCCACACACCCTTCCCAGAGCCTGCCCTCAGAAACAGGCTCCTGAAGGTGCCTGCCCATCACCTGAGG GCCAACGAGGTGACAGACAGTGCATA

TATGGGGTCTGAGAGCACCTACAGTGAGTGTGAGACCTTCACAGATGAGGACACCAGCACCCTGGTGCACCCCGAGCTGCAGCCTGAAGGGGACGTGGAC

AGTGCTGGTGGCTCAGGGGTGCCCTCTGAGTGCCTGGACACCATGGAGGAGCCTGACCATGGTGCATTGCTGCTGCTCCCAGGCAG ATCCCGCCCCCAC

AGCCAAGCTGTCGTCATGGTGATTGGCAGTGAGGAACATTTTGAAGATTATGGTGAGGGCAATGAGGCAGAACTATCCCCGGAGACCCTCTGCGATGGGG

ACGGCGAGGACCCTGCTTTTCTCACCCCCAG CCCAGCCAAGCGGCTCTCCAGCAGGAAGGTGGCAAG GTATCTGCACCAGTCGGGGACCCTGACTATG

GAGGCCCTGGAGGACCCTCCCCCAGAGCCTGTGGAGTGCCCAGAGGAGGACATTGCAGACAAG GTCATCTTCCTAGAGAGACGGGTGTCAGAGCTGGAG

AAGGACAGTGCAGCTGCTGGCGAGCAGCATGGCAGGCTGAGGCAAGAAAACCTCCAGCTGGTGCACAG AGCCAATGCCTTGGAAGAGCAGCTGAAGGAA

CAGGAGTTCAGAGCCCAAGAGAAGGTCCTAGAAGAAACCAGGAAGCAGAAGGAACTTCTGTGCAAGATGGAGCGTGAGAAGAGCATTGAGATCGAGAACC

TGCAGGCCAG GTTGCAGCAGCTGGATGAGGAGAACAGTGAGCTGCGGTCCTGCACACCCTGTCTGAAGGCCAACATCGAGCGCCTTGAGGAG GAGAAG

CAGAAGATGCTGGATGAGATTGAGGAGTTGACACAGCGGCTCAGTGAGGAACAGGAGAATAAGAGGAAAATGGGGGACAGGCTGAGCCATGAGCGGCACC

AATTCCAGAGAGACAAGGAAGCAACCCAGGAG CTGATCGAGGACCTCCGCAAGCAGCTAGAACATCTACAGCTCCTCAGACTGGAGGTGGAGCAGCGAC

GGGGCCGCAGCAGCAGCCTGGGCCTGCAGGAGTACAACAGCCGTGCACGGGAGAGCGAGCTGGAGCAGGAGGTCCGCAGACTCAAACAG GACAACCGTA

ACCTGAAGGAGCAAAATGATGAGCTAAATGGGCAGATCATCACCCTCAGCATCCAGGGTGCCAAGAGCCTCTTCTCCACGTCTTTCTCAGAATCACTGGC

TGCAGAAATCAGCTCTGTCTCCCGAGATGAG CTCATGGAAGCAATCCAGAAGCAGGAGGAGATCAATTTCCGCCTGCAGGACTACATTGACAGGATCAT

TGTGGCCATCCTGGAGACCAACCCATCCATCCTAGAGGTCAAGTAGTCCATCTTAGCCCAGTTTGGGCTGGTTAGAGACTCCACAGCACCCAGGAGTGGC

CCTGTCTTGCCACAAAGAGCCCGACCAGCAGGTCCTGCAGCTTACCAAGCCCAGGGTGTGTGGGGCCCTCACGCAGTTCGACTGGGAAAATACAGAAGGG

CTGCAGAGGCAATAAGAAGGAAGAAAGGGAAGTCCACGGCAGGCAAAGGGTGTGGCTGGCTCTCTGAACATCAGGAAACCAGGGCCTCCCACCACAAGCC

AGCCTCACCAACAACACCATGTCTGCTCAGCAGTATGCAGATATGTGGGGATAGTCTCTCAGGCTGGCATGGGCCCCTTTCTGCTATGCGCCCTATTAGG

AAGAGAGAGAGAGAGAAAGAGAGAGAGAGAGAATGAGTCCTCCCTCAGTTGCTGCCTCTCACTCCTGGTGACATGGTGCCACCCAAGCTTGGCCATTCCC

ACATAGTCAGCAAGCTGAGGACCCAAAGTTGGACACAGAAATGGTAGTGTTGGAAAGACAGACAGGCAAAGACGGCACACGTTGGGTCTGCTTCCAGTCC

ATAGGCCACCAATTCTCCTTGCGCTGCTCAGGCCTTCTCTCACCAGATGGGCTTCCATTCACCTTCGGACCCAGGGCCTCCAAGCCACACAGCTATTCTT

TGGCCAGACCCTCACTACAGTAACTCATCAACTCTGGCTCTTGTAGGGGCTGGAGCAGCTAGTTCATGCTGCCTGTGGAACTCACTTCCTGGACTGATGA

GCACGGTCAGCCTCTGTCCCCACTGCAGGTGCTGCTTCTCCTCAGGTGTGGCCTACCTAGGCTCCTGGACCCACACCCTCCTCAGGCTGACTTTACTGCC

TTGGGAGAAGTCTACATTTCCCAGACAATAGTCTAGGCCTCTGGAACAGTTTCCTTCTCTGCTTTTGACTTTAAATCCCTGGGTGTCCCCCAGGAGTCAG

TTTGCTAGTGGATAATGGAGGAGGTTCTACACTGACCCAGAGGCATAGGAAGGCTTGCTGTCTGCCCTGCACCACCCACAGAGCTGCGGCACCCATAGCA

GCTGGGCCTGAGCCTGAGCACTAGCCGGAGTCTGGGCACAGTGTCTGAGACCACACCATAGGCTGCGTGAGTGTGAGTGTGTATGGAAGTGTGTGCGCAA

GTGTGTGCGCATGCATGAGTGCGCACACAAGTTTGAGTGTATGAATTCTTGTGCCCACACATGCTGCCCTGCATCCCTTCACTGCCTATCCCCCTGCCCC

CGCCTCACACTACAGTTTAAGATGTTGCCTCGTATTGTACATTTTGGGGAAAGCCTTGTGTGTAAATCAGTGTAAACTTGGAGGAGAGATTTTTCTATCA

TGTAGAGTAGGTATTTTTTATAGATTGAAGGTTGATCAATTTTTTTAATACTTTCCAGAGAGAAAACTATCTGTGTATACATATGAAATATATATATATA

TATATGTATAATATATCAATACTGGAGCCCCGCCTTTCTGTGCCCAGGTCCAGGCCCTGTGTAAGGGCTTGCAGCCTGTCTCTGCTGTCCACCCTGCAGT

GCTCACTTTAAACACAGGTCTCTAGGAGACCCTGGGAAACACACCAATCACCAACTTGCTCATGACATTGCTTCAGCTCCCTGAGAAGTAGCTCTTCCTC

CAGGGCATGGAAGGATGGGAGGCCAGCAGGACCCTGCCCCATGTGTCAGCTACCACAGATTAAAGCTGTTACCGCACACGGA
Translation
 MGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGR RSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLC

DGDGEDPAFLTPS SPAKRLSSRKVAR RYLHQSGTLTMEALEDPPPEPVECPEEDIADK VIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHR RAN

ALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQAR RLQQLDEENSELRSCTPCLKANIERLEE EKQKMLDEIEELTQRLSEEQENKRK

MGDRLSHERHQFQRDKEATQE LIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQ DNRNLKEQNDELNGQIITLSIQGAK

SLFSTSFSESLAAEISSVSRDE LMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK
Transcript ENSMUST00000069854
Sequence
AGGAGCCAGACACACCGTGCCACTTGGCCAAGGAGTTGGAGGAACCCGACGCCCCTCGCTGCCTGCCCCAGGAGCCCGACACACCGTGCTACTTGGCCAA

AGAGCTAGAGGAACCCAACATCCCTCGGTGCTGGCCCCAGGAGCCCGACGTGCCGTGCCACTTGGCCAAGGAGCTAGAGGAACCCGACGCCCCTCGCTGC

TGGCCCCAGGAACCAGACGCATTCTGTCACTTGCTCAAGGAGGTGGAGGAACCTGATGCCCTTCGCTGCTGGCTTCAAGGGCCAGACGCACCGTGCCACT

TGGCCAAGGAACTGGAGGACCTCGACTCCCCTCGCTGCTGGCCCCAGGAGCCCGACGAATCCTGTCACTTGGCTAAGGAGCTGGAGGAACCAGACGCACC

GTGCCACTTAGCCAAAGAGCTGGAGGAACCCGACGCCCCTCGCTGCTGGCCCCAGGAGCCCGACGTGCCCTGTCTCTTGGCCAAAAAGTGGGAGGAATCC

GACGCACCGTGCCTCTTGACGGAGGAGCTGGAAGAGCCTGACGCCCTTCACTGCTGGCCCCAGGAGTCAGAGGCACCGTGTTTGTTGGCCAAGGAGCTAG

AAGAGCCTGATGCCTCTCACAGCTGTCCTCAGGAGGCGGACACAGGGTGCCTCTCGGCCAAGGAGCCAGAGGAGCCTGATGTCTCTCACCTGTGGCAGGG

GGTACCCGATGCACCGTGCCTCTTGGTCAAGGAACCAGAGGAGGCCGATGCACTTCACTGTTGTTGGCCCGAGGAATCCGAGGAGCCGGATGCTCTCAAC

CCACCGTGTTTCTGGGCCAATGAACCAGACGAGCCCGATCCATCACGATGTTGGTCAGAGGAGCCCCAGGTGCTGTGCCTCTGGCCGGAGGAGCAGAACA

CAAAGCGGTGCTGGCAGGAAGAGCCCGATGCACCCTGCTTCTGGCCCGAGGATCGAGAGGAACCCATAGTTTCGTGTCTTCAATTTAAAGAGCCAGAGAA

GCCCAAAGTCCGGAGCAGTTGGCCTGAGGAGCTGGAAGACTGCTGCCCTACGCGGGGCCTACCCCTTGAGCCCTTGCTCGCCGACGGCGAGCTGCTGCAG

GCATGTCCCGGGCCACCCTCGGACCCAGGACCAGCGTTGTCGCTGCCCAGCGAGCCCGGGACAGCTCAGGAGGAGGGTGCACGCCTCAGGGCGGTATTTG

ACGCCCTGGACAGAGATGGGGACGGCTTCGTCCGCATCGAGGATTTCATCCAATTCGCCACGGTCTATGGGGCAGAGCAG - UNI7802 - - UNI27

988 - - UNI29393 - GTGAAGGACTTAACTCAGTACCTGGACCCGAGTGGGCTTGGCGTAATCAGCTTTGAAGATTTCTACCAAGGGATTGTAGCC

ATCAGAAATGGAG - UNI27988 - ATCCTGATGGCCAGTTGTACAGCGTGGAGCCTGTCCAAGATGAAGAGACCCCTGCCTGTGCCGATGAGTTTGA

CGACTTTGTCACCTATGAG - UNI3676 - GCCAACGAGGTGACAGACAGTGCATATATGGGGTCTGAGAGCACCTACAGTGAGTGTGAGACCTTCAC

AGATGAGGACACCAGCACCCTGGTGCACCCCGAGCTGCAGCCTGAAGGGGACGTGGACAGTGCTGGTGGCTCAGGGGTGCCCTCTGAGTGCCTGGACACC

ATGGAGGAGCCTGACCATGGTGCATTGCTGCTGCTCCCAGGCAG ATCCCGCCCCCACAGCCAAGCTGTCGTCATGGTGATTGGCAGTGAGGAACATTTT

GAAGATTATGGTGAGGGCAATGAGGCAGAACTATCCCCGGAGACCCTCTGCGATGGGGACGGCGAGGACCCTGCTTTTCTCACCCCCAG CCCAGCCAAG

CGGCTCTCCAGCAGGAAGGTGGCAAG GTATCTGCACCAGTCGGGGACCCTGACTATGGAGGCCCTGGAGGACCCTCCCCCAGAGCCTGTGGAGTGCCCA

GAGGAGGACATTGCAGACAAG GTCATCTTCCTAGAGAGACGGGTGTCAGAGCTGGAGAAGGACAGTGCAGCTGCTGGCGAGCAGCATGGCAGGCTGAGG

CAAGAAAACCTCCAGCTGGTGCACAG AGCCAATGCCTTGGAAGAGCAGCTGAAGGAACAGGAGTTCAGAGCCCAAGAGAAGGTCCTAGAAGAAACCAGG

AAGCAGAAGGAACTTCTGTGCAAGATGGAGCGTGAGAAGAGCATTGAGATCGAGAACCTGCAGGCCAG GTTGCAGCAGCTGGATGAGGAGAACAGTGAG

CTGCGGTCCTGCACACCCTGTCTGAAGGCCAACATCGAGCGCCTTGAGGAG GAGAAGCAGAAGATGCTGGATGAGATTGAGGAGTTGACACAGCGGCTC

AGTGAGGAACAGGAGAATAAGAGGAAAATGGGGGACAGGCTGAGCCATGAGCGGCACCAATTCCAGAGAGACAAGGAAGCAACCCAGGAG CTGATCGAG

GACCTCCGCAAGCAGCTAGAACATCTACAGCTCCTCAGACTGGAGGTGGAGCAGCGACGGGGCCGCAGCAGCAGCCTGGGCCTGCAGGAGTACAACAGCC

GTGCACGGGAGAGCGAGCTGGAGCAGGAGGTCCGCAGACTCAAACAG GACAACCGTAACCTGAAGGAGCAAAATGATGAGCTAAATGGGCAGATCATCA

CCCTCAGCATCCAGGGTGCCAAGAGCCTCTTCTCCACGTCTTTCTCAGAATCACTGGCTGCAGAAATCAGCTCTGTCTCCCGAGATGAG CTCATGGAAG

CAATCCAGAAGCAGGAGGAGATCAATTTCCGCCTGCAGGACTACATTGACAGGATCATTGTGGCCATCCTGGAGACCAACCCATCCATCCTAGAGGTCAA

GTAGTCCATCTTAGCCCAGTTTGGGCTGGTTAGAGACTCCACAGCACCCAGGAGTGGCCCTGTCTTGCCACAAAGAGCCCGACCAGCAGGTCCTGCAGCT

TACCAAGCCCAGGGTGTGTGGGGCCCTCACGCAGTTCGACTGGGAAAATACAGAAGGGCTGCAGAGGCAATAAGAAGGAAGAAAGGGAAGTCCACGGCAG

GCAAAGGGTGTGGCTGGCTCTCTGAACATCAGGAAACCAGGGCCTCCCACCACAAGCCAGCCTCACCAACAACACCATGTCTGCTCAGCAGTATGCAGAT

ATGTGGGGATAGTCTCTCAGGCTGGCATGGGCCCCTTTCTGCTATGCGCCCTATTAGGAAGAGAGAGAGAGAGAAAGAGAGAGAGAGAGAATGAGTCCTC

CCTCAGTTGCTGCCTCTCACTCCTGGTGACATGGTGCCACCCAAGCTTGGCCATTCCCACATAGTCAGCAAGCTGAGGACCCAAAGTTGGACACAGAAAT

GGTAGTGTTGGAAAGACAGACAGGCAAAGACGGCACACGTTGGGTCTGCTTCCAGTCCATAGGCCACCAATTCTCCTTGCGCTGCTCAGGCCTTCTCTCA

CCAGATGGGCTTCCATTCACCTTCGGACCCAGGGCCTCCAAGCCACACAGCTATTCTTTGGCCAGACCCTCACTACAGTAACTCATCAACTCTGGCTCTT

GTAGGGGCTGGAGCAGCTAGTTCATGCTGCCTGTGGAACTCACTTCCTGGACTGATGAGCACGGTCAGCCTCTGTCCCCACTGCAGGTGCTGCTTCTCCT

CAGGTGTGGCCTACCTAGGCTCCTGGACCCACACCCTCCTCAGGCTGACTTTACTGCCTTGGGAGAAGTCTACATTTCCCAGACAATAGTCTAGGCCTCT

GGAACAGTTTCCTTCTCTGCTTTTGACTTTAAATCCCTGGGTGTCCCCCAGGAGTCAGTTTGCTAGTGGATAATGGAGGAGGTTCTACACTGACCCAGAG

GCATAGGAAGGCTTGCTGTCTGCCCTGCACCACCCACAGAGCTGCGGCACCCATAGCAGCTGGGCCTGAGCCTGAGCACTAGCCGGAGTCTGGGCACAGT

GTCTGAGACCACACCATAGGCTGCGTGAGTGTGAGTGTGTATGGAAGTGTGTGCGCAAGTGTGTGCGCATGCATGAGTGCGCACACAAGTTTGAGTGTAT

GAATTCTTGTGCCCACACATGCTGCCCTGCATCCCTTCACTGCCTATCCCCCTGCCCCCGCCTCACACTACAGTTTAAGATGTTGCCTCGTATTGTACAT

TTTGGGGAAAGCCTTGTGTGTAAATCAGTGTAAACTTGGAGGAGAGATTTTTCTATCATGTAGAGTAGGTATTTTTTATAGATTGAAGGTTGATCAATTT

TTTTAATACTTTCCAGAGAGAAAACTATCTGTGTATACATATGAAATATATATATATATATATGTATAATATATCAATACTGGAGCCCCGCCTTTCTGTG

CCCAGGTCCAGGCCCTGTGTAAGGGCTTGCAGCCTGTCTCTGCTGTCCACCCTGCAGTGCTCACTTTAAACACAGGTCTCTAGGAGACCCTGGGAAACAC

ACCAATCACCAACTTGCTCATGACATTGCTTCAGCTCCCTGAGAAGTAGCTCTTCCTCCAGGGCATGGAAGGATGGGAGGCCAGCAGGACCCTGCCCCAT

GTGTCAGCTACCACAGATTAAAGCTGTTACC
Translation
 - UNI7802 - - UNI27988 - - UNI29393 -  - UNI27988 -  - UNI3676 - MGSESTYSECETFTDEDTSTLVHPELQPEGDVDS

AGGSGVPSECLDTMEEPDHGALLLLPGR RSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPS SPAKRLSSRKVAR RYLHQSG

TLTMEALEDPPPEPVECPEEDIADK VIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHR RANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREK

SIEIENLQAR RLQQLDEENSELRSCTPCLKANIERLEE EKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQE LIEDLRKQLEHLQ

LLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQ DNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDE LMEAIQKQEEIN

FRLQDYIDRIIVAILETNPSILEVK
Transcript ENSMUST00000075024
Sequence
AGGAGCCAGACACACCGTGCCACTTGGCCAAGGAGTTGGAGGAACCCGACGCCCCTCGCTGCCTGCCCCAGGAGCCCGACACACCGTGCTACTTGGCCAA

AGAGCTAGAGGAACCCAACATCCCTCGGTGCTGGCCCCAGGAGCCCGACGTGCCGTGCCACTTGGCCAAGGAGCTAGAGGAACCCGACGCCCCTCGCTGC

TGGCCCCAGGAACCAGACGCATTCTGTCACTTGCTCAAGGAGGTGGAGGAACCTGATGCCCTTCGCTGCTGGCTTCAAGGGCCAGACGCACCGTGCCACT

TGGCCAAGGAACTGGAGGACCTCGACTCCCCTCGCTGCTGGCCCCAGGAGCCCGACGAATCCTGTCACTTGGCTAAGGAGCTGGAGGAACCAGACGCACC

GTGCCACTTAGCCAAAGAGCTGGAGGAACCCGACGCCCCTCGCTGCTGGCCCCAGGAGCCCGACGTGCCCTGTCTCTTGGCCAAAAAGTGGGAGGAATCC

GACGCACCGTGCCTCTTGACGGAGGAGCTGGAAGAGCCTGACGCCCTTCACTGCTGGCCCCAGGAGTCAGAGGCACCGTGTTTGTTGGCCAAGGAGCTAG

AAGAGCCTGATGCCTCTCACAGCTGTCCTCAGGAGGCGGACACAGGGTGCCTCTCGGCCAAGGAGCCAGAGGAGCCTGATGTCTCTCACCTGTGGCAGGG

GGTACCCGATGCACCGTGCCTCTTGGTCAAGGAACCAGAGGAGGCCGATGCACTTCACTGTTGTTGGCCCGAGGAATCCGAGGAGCCGGATGCTCTCAAC

CCACCGTGTTTCTGGGCCAATGAACCAGACGAGCCCGATCCATCACGATGTTGGTCAGAGGAGCCCCAGGTGCTGTGCCTCTGGCCGGAGGAGCAGAACA

CAAAGCGGTGCTGGCAGGAAGAGCCCGATGCACCCTGCTTCTGGCCCGAGGATCGAGAGGAACCCATAGTTTCGTGTCTTCAATTTAAAGAGCCAGAGAA

GCCCAAAGTCCGGAGCAGTTGGCCTGAGGAGCTGGAAGACTGCTGCCCTACGCGGGGCCTACCCCTTGAGCCCTTGCTCGCCGACGGCGAGCTGCTGCAG

GCATGTCCCGGGCCACCCTCGGACCCAGGACCAGCGTTGTCGCTGCCCAGCGAGCCCGGGACAGCTCAGGAGGAGGGTGCACGCCTCAGGGCGGTATTTG

ACGCCCTGGACAGAGATGGGGACGGCTTCGTCCGCATCGAGGATTTCATCCAATTCGCCACGGTCTATGGGGCAGAGCAG - UNI7802 - - UNI27

988 - - UNI29393 - GTGAAGGACTTAACTCAGTACCTGGACCCGAGTGGGCTTGGCGTAATCAGCTTTGAAGATTTCTACCAAGGGATTGTAGCC

ATCAGAAATGGAG - UNI27988 - ATCCTGATGGCCAGTTGTACAGCGTGGAGCCTGTCCAAGATGAAGAGACCCCTGCCTGTGCCGATGAGTTTGA

CGACTTTGTCACCTATGAG - UNI3676 - GCCAACGAGGTGACAGACAGTGCATATATGGGGTCTGAGAGCACCTACAGTGAGTGTGAGACCTTCAC

AGATGAGGACACCAGCACCCTGGTGCACCCCGAGCTGCAGCCTGAAGGGGACGTGGACAGTGCTGGTGGCTCAGGGGTGCCCTCTGAGTGCCTGGACACC

ATGGAGGAGCCTGACCATGGTGCATTGCTGCTGCTCCCAGGCAG ATCCCGCCCCCACAGCCAAGCTGTCGTCATGGTGATTGGCAGTGAGGAACATTTT

GAAGATTATGGTGAGGGCAATGAGGCAGAACTATCCCCGGAGACCCTCTGCGATGGGGACGGCGAGGACCCTGCTTTTCTCACCCCCAG CTCCAACCCT

CTTGCCTCAAAGCTGTGCGACGTCCTCACTGACGAGGCCTTTGAGTTTTACTGTAGCCAGTGCCATAAACAGATCAACCGCCTTGAGGATCTGTCTGCCC

GCCTGACTGATCTTGAGATGAATAG CCCAGCCAAGCGGCTCTCCAGCAGGAAGGTGGCAAG GTATCTGCACCAGTCGGGGACCCTGACTATGGAGGCC

CTGGAGGACCCTCCCCCAGAGCCTGTGGAGTGCCCAGAGGAGGACATTGCAGACAAG GTCATCTTCCTAGAGAGACGGGTGTCAGAGCTGGAGAAGGAC

AGTGCAGCTGCTGGCGAGCAGCATGGCAGGCTGAGGCAAGAAAACCTCCAGCTGGTGCACAG AGCCAATGCCTTGGAAGAGCAGCTGAAGGAACAGGAG

TTCAGAGCCCAAGAGAAGGTCCTAGAAGAAACCAGGAAGCAGAAGGAACTTCTGTGCAAGATGGAGCGTGAGAAGAGCATTGAGATCGAGAACCTGCAGG

CCAG GTTGCAGCAGCTGGATGAGGAGAACAGTGAGCTGCGGTCCTGCACACCCTGTCTGAAGGCCAACATCGAGCGCCTTGAGGAG GAGAAGCAGAAG

ATGCTGGATGAGATTGAGGAGTTGACACAGCGGCTCAGTGAGGAACAGGAGAATAAGAGGAAAATGGGGGACAGGCTGAGCCATGAGCGGCACCAATTCC

AGAGAGACAAGGAAGCAACCCAGGAG CTGATCGAGGACCTCCGCAAGCAGCTAGAACATCTACAGCTCCTCAGACTGGAGGTGGAGCAGCGACGGGGCC

GCAGCAGCAGCCTGGGCCTGCAGGAGTACAACAGCCGTGCACGGGAGAGCGAGCTGGAGCAGGAGGTCCGCAGACTCAAACAG GACAACCGTAACCTGA

AGGAGCAAAATGATGAGCTAAATGGGCAGATCATCACCCTCAGCATCCAGGGTGCCAAGAGCCTCTTCTCCACGTCTTTCTCAGAATCACTGGCTGCAGA

AATCAGCTCTGTCTCCCGAGATGAG CTCATGGAAGCAATCCAGAAGCAGGAGGAGATCAATTTCCGCCTGCAGGACTACATTGACAGGATCATTGTGGC

CATCCTGGAGACCAACCCATCCATCCTAGAGGTCAAGTAGTCCATCTTAGCCCAGTTTGGGCTGGTTAGAGACTCCACAGCACCCAGGAGTGGCCCTGTC

TTGCCACAAAGAGCCCGACCAGCAGGTCCTGCAGCTTACCAAGCCCAGGGTGTGTGGGGCCCTCACGCAGTTCGACTGGGAAAATACAGAAGGGCTGCAG

AGGCAATAAGAAGGAAGAAAGGGAAGTCCACGGCAGGCAAAGGGTGTGGCTGGCTCTCTGAACATCAGGAAACCAGGGCCTCCCACCACAAGCCAGCCTC

ACCAACAACACCATGTCTGCTCAGCAGTATGCAGATATGTGGGGATAGTCTCTCAGGCTGGCATGGGCCCCTTTCTGCTATGCGCCCTATTAGGAAGAGA

GAGAGAGAGAAAGAGAGAGAGAGAGAATGAGTCCTCCCTCAGTTGCTGCCTCTCACTCCTGGTGACATGGTGCCACCCAAGCTTGGCCATTCCCACATAG

TCAGCAAGCTGAGGACCCAAAGTTGGACACAGAAATGGTAGTGTTGGAAAGACAGACAGGCAAAGACGGCACACGTTGGGTCTGCTTCCAGTCCATAGGC

CACCAATTCTCCTTGCGCTGCTCAGGCCTTCTCTCACCAGATGGGCTTCCATTCACCTTCGGACCCAGGGCCTCCAAGCCACACAGCTATTCTTTGGCCA

GACCCTCACTACAGTAACTCATCAACTCTGGCTCTTGTAGGGGCTGGAGCAGCTAGTTCATGCTGCCTGTGGAACTCACTTCCTGGACTGATGAGCACGG

TCAGCCTCTGTCCCCACTGCAGGTGCTGCTTCTCCTCAGGTGTGGCCTACCTAGGCTCCTGGACCCACACCCTCCTCAGGCTGACTTTACTGCCTTGGGA

GAAGTCTACATTTCCCAGACAATAGTCTAGGCCTCTGGAACAGTTTCCTTCTCTGCTTTTGACTTTAAATCCCTGGGTGTCCCCCAGGAGTCAGTTTGCT

AGTGGATAATGGAGGAGGTTCTACACTGACCCAGAGGCATAGGAAGGCTTGCTGTCTGCCCTGCACCACCCACAGAGCTGCGGCACCCATAGCAGCTGGG

CCTGAGCCTGAGCACTAGCCGGAGTCTGGGCACAGTGTCTGAGACCACACCATAGGCTGCGTGAGTGTGAGTGTGTATGGAAGTGTGTGCGCAAGTGTGT

GCGCATGCATGAGTGCGCACACAAGTTTGAGTGTATGAATTCTTGTGCCCACACATGCTGCCCTGCATCCCTTCACTGCCTATCCCCCTGCCCCCGCCTC

ACACTACAGTTTAAGATGTTGCCTCGTATTGTACATTTTGGGGAAAGCCTTGTGTGTAAATCAGTGTAAACTTGGAGGAGAGATTTTTCTATCATGTAGA

GTAGGTATTTTTTATAGATTGAAGGTTGATCAATTTTTTTAATACTTTCCAGAGAGAAAACTATCTGTGTATACATATGAAATATATATATATATATATG

TATAATATATCAATACTGGAGCCCCGCCTTTCTGTGCCCAGGTCCAGGCCCTGTGTAAGGGCTTGCAGCCTGTCTCTGCTGTCCACCCTGCAGTGCTCAC

TTTAAACACAGGTCTCTAGGAGACCCTGGGAAACACACCAATCACCAACTTGCTCATGACATTGCTTCAGCTCCCTGAGAAGTAGCTCTTCCTCCAGGGC

ATGGAAGGATGGGAGGCCAGCAGGACCCTGCCCCATGTGTCAGCTACCACAGATTAAAGCTGTTACC
Translation
EEPDALRCWLQGPDAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPCHLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDA

LHCWPQESEAPCLLAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCCWPEESEEPDALNPPCFWANEPDEPDPS

RCWSEEPQVLCLWPEEQNTKRCWQEEPDAPCFWPEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSDPGPALSL

PSEPGTAQEEGARLRAVFDALDRDGDGFVRIEDFIQFATVYGAEQ - UNI7802 - - UNI27988 - - UNI29393 - VKDLTQYLDPSGLGVI

SFEDFYQGIVAIRNGD - UNI27988 - DPDGQLYSVEPVQDEETPACADEFDDFVTYE - UNI3676 - ANEVTDSAYMGSESTYSECETFTDED

TSTLVHPELQPEGDVDSAGGSGVPSECLDTMEEPDHGALLLLPGR RSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPS SSNP

LASKLCDVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMNS SPAKRLSSRKVAR RYLHQSGTLTMEALEDPPPEPVECPEEDIADK VIFLERRVSE

LEKDSAAAGEQHGRLRQENLQLVHR RANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQAR RLQQLDEENSELRSCTPCLKANIER

LEE EKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQE LIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRR

LKQ DNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDE LMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK
Transcript ENSMUST00000120691
Sequence
CCGCTGCCATGGGCCCGCGCCAGCCGCGCTGCGGGGCCGGGAGCCGCTAAGGTGCGGTGCGAAGATGGGCGAGGGCGGAGCAGGGCCCGAGCGCCAGCCT

CAGCAGTCCGGGCGCCCCGCGCGCGCCCGCCCGCGTCGCCGCGGGGATGCCCGCGCCCGCCGCCGCGCCCTGAGCGCCTTTGTCTGCCTTCCGCGCCTTT

CGTATCATCCCTAGTTTAGCCGGCGCCGGATCATGGAGCTGTGCCAGCCGACCTCCCTGTCAGACCACGACCAGCCAGCGTCTGGGCCCCAGCGTGGGGT

CATGGGGCTGGTGGGGCCCGACGCTCCTCGCGGCTGGTCAGAAGAGCCCGAGGAACACGCCCAGCTTCAACGGTGGCCAGAGGGACCCAACGCGCCAATC

TGCTGGCCCGAGGAGGTAGAGGAGCCTCACGCTCCTAGTCGCTGGGCCAAAGAGCCCAATGCCCCTCGCTGCTCGTCCCAGGAGCCCGATGAATCCTGTC

ACTTGGCAGAGGAGCTGGAGGAATCCGACTCCCCTCGCTGCTGGCCCCAGGAGCCAGACACACCGTGCCACTTGGCCAAGGAGTTGGAGGAACCCGACGC

CCCTCGCTGCCTGCCCCAGGAGCCCGACACACCGTGCTACTTGGCCAAAGAGCTAGAGGAACCCAACATCCCTCGGTGCTGGCCCCAGGAGCCCGACGTG

CCGTGCCACTTGGCCAAGGAGCTAGAGGAACCCGACGCCCCTCGCTGCTGGCCCCAGGAACCAGACGCATTCTGTCACTTGCTCAAGGAGGTGGAGGAAC

CTGATGCCCTTCGCTGCTGGCTTCAAGGGCCAGACGCACCGTGCCACTTGGCCAAGGAACTGGAGGACCTCGACTCCCCTCGCTGCTGGCCCCAGGAGCC

CGACGAATCCTGTCACTTGGCTAAGGAGCTGGAGGAACCAGACGCACCGTGCCACTTAGCCAAAGAGCTGGAGGAACCCGACGCCCCTCGCTGCTGGCCC

CAGGAGCCCGACGTGCCCTGTCTCTTGGCCAAAAAGTGGGAGGAATCCGACGCACCGTGCCTCTTGACGGAGGAGCTGGAAGAGCCTGACGCCCTTCACT

GCTGGCCCCAGGAGTCAGAGGCACCGTGTTTGTTGGCCAAGGAGCTAGAAGAGCCTGATGCCTCTCACAGCTGTCCTCAGGAGGCGGACACAGGGTGCCT

CTCGGCCAAGGAGCCAGAGGAGCCTGATGTCTCTCACCTGTGGCAGGGGGTACCCGATGCACCGTGCCTCTTGGTCAAGGAACCAGAGGAGGCCGATGCA

CTTCACTGTTGTTGGCCCGAGGAATCCGAGGAGCCGGATGCTCTCAACCCACCGTGTTTCTGGGCCAATGAACCAGACGAGCCCGATCCATCACGATGTT

GGTCAGAGGAGCCCCAGGTGCTGTGCCTCTGGCCGGAGGAGCAGAACACAAAGCGGTGCTGGCAGGAAGAGCCCGATGCACCCTGCTTCTGGCCCGAGGA

TCGAGAGGAACCCATAGTTTCGTGTCTTCAATTTAAAGAGCCAGAGAAGCCCAAAGTCCGGAGCAGTTGGCCTGAGGAGCTGGAAGACTGCTGCCCTACG

CGGGGCCTACCCCTTGAGCCCTTGCTCGCCGACGGCGAGCTGCTGCAGGCATGTCCCGGGCCACCCTCGGACCCAGGACCAGCGTTGTCGCTGCCCAGCG

AGCCCGGGACAGCTCAGGAGGAGGGTGCACGCCTCAGGGCGGTATTTGACGCCCTGGACAGAGATGGGGACGGCTTCGTCCGCATCGAGGATTTCATCCA

ATTCGCCACGGTCTATGGGGCAGAGCAG - UNI7802 - - UNI27988 - - UNI29393 - GTGAAGGACTTAACTCAGTACCTGGACCCGAGT

GGGCTTGGCGTAATCAGCTTTGAAGATTTCTACCAAGGGATTGTAGCCATCAGAAATGGAG - UNI27988 - ATCCTGATGGCCAGTTGTACAGCGT

GGAGCCTGTCCAAGATGAAGAGACCCCTGCCTGTGCCGATGAGTTTGACGACTTTGTCACCTATGAG - UNI3676 - GCCAACGAGGTGACAGACAG

TGCATATATGGGGTCTGAGAGCACCTACAGTGAGTGTGAGACCTTCACAGATGAGGACACCAGCACCCTGGTGCACCCCGAGCTGCAGCCTGAAGGGGAC

GTGGACAGTGCTGGTGGCTCAGGGGTGCCCTCTGAGTGCCTGGACACCATGGAGGAGCCTGACCATGGTGCATTGCTGCTGCTCCCAGGCAG ATCCCGC

CCCCACAGCCAAGCTGTCGTCATGGTGATTGGCAGTGAGGAACATTTTGAAGATTATGGTGAGGGCAATGAGGCAGAACTATCCCCGGAGACCCTCTGCG

ATGGGGACGGCGAGGACCCTGCTTTTCTCACCCCCAG CCCAGCCAAGCGGCTCTCCAGCAGGAAGGTGGCAAG GTATCTGCACCAGTCGGGGACCCTG

ACTATGGAGGCCCTGGAGGACCCTCCCCCAGAGCCTGTGGAGTGCCCAGAGGAGGACATTGCAGACAAG GTCATCTTCCTAGAGAGACGGGTGTCAGAG

CTGGAGAAGGACAGTGCAGCTGCTGGCGAGCAGCATGGCAGGCTGAGGCAAGAAAACCTCCAGCTGGTGCACAG AGCCAATGCCTTGGAAGAGCAGCTG

AAGGAACAGGAGTTCAGAGCCCAAGAGAAGGTCCTAGAAGAAACCAGGAAGCAGAAGGAACTTCTGTGCAAGATGGAGCGTGAGAAGAGCATTGAGATCG

AGAACCTGCAGGCCAG GTTGCAGCAGCTGGATGAGGAGAACAGTGAGCTGCGGTCCTGCACACCCTGTCTGAAGGCCAACATCGAGCGCCTTGAGGAG 

GAGAAGCAGAAGATGCTGGATGAGATTGAGGAGTTGACACAGCGGCTCAGTGAGGAACAGGAGAATAAGAGGAAAATGGGGGACAGGCTGAGCCATGAGC

GGCACCAATTCCAGAGAGACAAGGAAGCAACCCAGGAG CTGATCGAGGACCTCCGCAAGCAGCTAGAACATCTACAGCTCCTCAGACTGGAGGTGGAGC

AGCGACGGGGCCGCAGCAGCAGCCTGGGCCTGCAGGAGTACAACAGCCGTGCACGGGAGAGCGAGCTGGAGCAGGAGGTCCGCAGACTCAAACAG GACA

ACCGTAACCTGAAGGAGCAAAATGATGAGCTAAATGGGCAGATCATCACCCTCAGCATCCAGGGTGCCAAGAGCCTCTTCTCCACGTCTTTCTCAGAATC

ACTGGCTGCAGAAATCAGCTCTGTCTCCCGAGATGAG CTCATGGAAGCAATCCAGAAGCAGGAGGAGATCAATTTCCGCCTGCAGGACTACATTGACAG

GATCATTGTGGCCATCCTGGAGACCAACCCATCCATCCTAGAGGTCAAGTAGTCCATCTTAGCCCAGTTTGGGCTGGTTAGAGACTCCACAGCACCCAGG

AGTGGCCCTGTCTTGCCACAAAGAGCCCGACCAGCAGGTCCTGCAGCTTACCAAGCCCAGGGTGTGTGGGGCCCTCACGCAGTTCGACTGGGAAAATACA

GAAGGGCTGCAGAGGCAATAAGAAGGAAGAAAGGGAAGTCCACGGCAGGCAAAGGGTGTGGCTGGCTCTCTGAACATCAGGAAACCAGGGCCTCCCACCA

CAAGCCAGCCTCACCAACAACACCATGTCTGCTCAGCAGTATGCAGATATGTGGGGATAGTCTCTCAGGCTGGCATGGGCCCCTTTCTGCTATGCGCCCT

ATTAGGAAGAGAGAGAGAGAGAAAGAGAGAGAGAGAGAATGAGTCCTCCCTCAGTTGCTGCCTCTCACTCCTGGTGACATGGTGCCACCCAAGCTTGGCC

ATTCCCACATAGTCAGCAAGCTGAGGACCCAAAGTTGGACACAGAAATGGTAGTGTTGGAAAGACAGACAGGCAAAGACGGCACACGTTGGGTCTGCTTC

CAGTCCATAGGCCACCAATTCTCCTTGCGCTGCTCAGGCCTTCTCTCACCAGATGGGCTTCCATTCACCTTCGGACCCAGGGCCTCCAAGCCACACAGCT

ATTCTTTGGCCAGACCCTCACTACAGTAACTCATCAACTCTGGCTCTTGTAGGGGCTGGAGCAGCTAGTTCATGCTGCCTGTGGAACTCACTTCCTGGAC

TGATGAGCACGGTCAGCCTCTGTCCCCACTGCAGGTGCTGCTTCTCCTCAGGTGTGGCCTACCTAGGCTCCTGGACCCACACCCTCCTCAGGCTGACTTT

ACTGCCTTGGGAGAAGTCTACATTTCCCAGACAATAGTCTAGGCCTCTGGAACAGTTTCCTTCTCTGCTTTTGACTTTAAATCCCTGGGTGTCCCCCAGG

AGTCAGTTTGCTAGTGGATAATGGAGGAGGTTCTACACTGACCCAGAGGCATAGGAAGGCTTGCTGTCTGCCCTGCACCACCCACAGAGCTGCGGCACCC

ATAGCAGCTGGGCCTGAGCCTGAGCACTAGCCGGAGTCTGGGCACAGTGTCTGAGACCACACCATAGGCTGCGTGAGTGTGAGTGTGTATGGAAGTGTGT

GCGCAAGTGTGTGCGCATGCATGAGTGCGCACACAAGTTTGAGTGTATGAATTCTTGTGCCCACACATGCTGCCCTGCATCCCTTCACTGCCTATCCCCC

TGCCCCCGCCTCACACTACAGTTTAAGATGTTGCCTCGTATTGTACATTTTGGGGAAAGCCTTGTGTGTAAATCAGTGTAAACTTGGAGGAGAGATTTTT

CTATCATGTAGAGTAGGTATTTTTTATAGATTGAAGGTTGATCAATTTTTTTAATACTTTCCAGAGAGAAAACTATCTGTGTATACATATGAAATATATA

TATATATATATGTATAATATATCAATACTGGAGCCCCGCCTTTCTGTGCCCAGGTCCAGGCCCTGTGTAAGGGCTTGCAGCCTGTCTCTGCTGTCCACCC

TGCAGTGCTCACTTTAAACACAGGTCTCTAGGAGACCCTGGGAAACACACCAATCACCAACTTGCTCATGACATTGCTTCAGCTCCCTGAGAAGTAGCTC

TTCCTCCAGGGCATGGAAGGATGGGAGGCCAGCAGGACCCTGCCCCATGTGTCAGCTACCACAGATTAAAGCTGTTACC
Translation
MELCQPTSLSDHDQPASGPQRGVMGLVGPDAPRGWSEEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPSRWAKEPNAPRCSSQEPDESCHLAEELEESDS

PRCWPQEPDTPCHLAKELEEPDAPRCLPQEPDTPCYLAKELEEPNIPRCWPQEPDVPCHLAKELEEPDAPRCWPQEPDAFCHLLKEVEEPDALRCWLQGP

DAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPCHLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDALHCWPQESEAPCL

LAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCCWPEESEEPDALNPPCFWANEPDEPDPSRCWSEEPQVLCLW

PEEQNTKRCWQEEPDAPCFWPEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSDPGPALSLPSEPGTAQEEGAR

LRAVFDALDRDGDGFVRIEDFIQFATVYGAEQ - UNI7802 - - UNI27988 - - UNI29393 - VKDLTQYLDPSGLGVISFEDFYQGIVAIR

NGD - UNI27988 - DPDGQLYSVEPVQDEETPACADEFDDFVTYE - UNI3676 - ANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEG

DVDSAGGSGVPSECLDTMEEPDHGALLLLPGR RSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPS SPAKRLSSRKVAR RYL

HQSGTLTMEALEDPPPEPVECPEEDIADK VIFLERRVSELEKDSAAAGEQHGRLRQENLQLVHR RANALEEQLKEQEFRAQEKVLEETRKQKELLCKM

EREKSIEIENLQAR RLQQLDEENSELRSCTPCLKANIERLEE EKQKMLDEIEELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQE LIEDLRKQL

EHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQ DNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDE LMEAIQKQ

EEINFRLQDYIDRIIVAILETNPSILEVK
Transcript ENSMUST00000122103
Sequence
ATGGAGCTGTGCCAGCCGACCTCCCTGTCAGACCACGACCAGCCAGCGTCTGGGCCCCAGCGTGGGGTCATGGGGCTGGTGGGGCCCGACGCTCCTCGCG

GCTGGTCAGAAGAGCCCGAGGAACACGCCCAGCTTCAACGGTGGCCAGAGGGACCCAACGCGCCAATCTGCTGGCCCGAGGAGGTAGAGGAGCCTCACGC

TCCTAGTCGCTGGGCCAAAGAGCCCAATGCCCCTCGCTGCTCGTCCCAGGAGCCCGATGAATCCTGTCACTTGGCAGAGGAGCTGGAGGAATCCGACTCC

CCTCGCTGCTGGCCCCAGGAGCCAGACACACCGTGCCACTTGGCCAAGGAGTTGGAGGAACCCGACGCCCCTCGCTGCCTGCCCCAGGAGCCCGACACAC

CGTGCTACTTGGCCAAAGAGCTAGAGGAACCCAACATCCCTCGGTGCTGGCCCCAGGAGCCCGACGTGCCGTGCCACTTGGCCAAGGAGCTAGAGGAACC

CGACGCCCCTCGCTGCTGGCCCCAGGAACCAGACGCATTCTGTCACTTGCTCAAGGAGGTGGAGGAACCTGATGCCCTTCGCTGCTGGCTTCAAGGGCCA

GACGCACCGTGCCACTTGGCCAAGGAACTGGAGGACCTCGACTCCCCTCGCTGCTGGCCCCAGGAGCCCGACGAATCCTGTCACTTGGCTAAGGAGCTGG

AGGAACCAGACGCACCGTGCCACTTAGCCAAAGAGCTGGAGGAACCCGACGCCCCTCGCTGCTGGCCCCAGGAGCCCGACGTGCCCTGTCTCTTGGCCAA

AAAGTGGGAGGAATCCGACGCACCGTGCCTCTTGACGGAGGAGCTGGAAGAGCCTGACGCCCTTCACTGCTGGCCCCAGGAGTCAGAGGCACCGTGTTTG

TTGGCCAAGGAGCTAGAAGAGCCTGATGCCTCTCACAGCTGTCCTCAGGAGGCGGACACAGGGTGCCTCTCGGCCAAGGAGCCAGAGGAGCCTGATGTCT

CTCACCTGTGGCAGGGGGTACCCGATGCACCGTGCCTCTTGGTCAAGGAACCAGAGGAGGCCGATGCACTTCACTGTTGTTGGCCCGAGGAATCCGAGGA

GCCGGATGCTCTCAACCCACCGTGTTTCTGGGCCAATGAACCAGACGAGCCCGATCCATCACGATGTTGGTCAGAGGAGCCCCAGGTGCTGTGCCTCTGG

CCGGAGGAGCAGAACACAAAGCGGTGCTGGCAGGAAGAGCCCGATGCACCCTGCTTCTGGCCCGAGGATCGAGAGGAACCCATAGTTTCGTGTCTTCAAT

TTAAAGAGCCAGAGAAGCCCAAAGTCCGGAGCAGTTGGCCTGAGGAGCTGGAAGACTGCTGCCCTACGCGGGGCCTACCCCTTGAGCCCTTGCTCGCCGA

CGGCGAGCTGCTGCAGGCATGTCCCGGGCCACCCTCGGACCCAGGACCAGCGTTGTCGCTGCCCAGCGAGCCCGGGACAGCTCAGGAGGAGGGTGCACGC

CTCAGGGCGGTATTTGACGCCCTGGACAGAGATGGGGACGGCTTCGTCCGCATCGAGGATTTCATCCAATTCGCCACGGTCTATGGGGCAGAGCAG - U

NI7802 - - UNI27988 - - UNI29393 - GTGAAGGACTTAACTCAGTACCTGGACCCGAGTGGGCTTGGCGTAATCAGCTTTGAAGATTTCTA

CCAAGGGATTGTAGCCATCAGAAATGGAG - UNI27988 - ATCCTGATGGCCAGTTGTACAGCGTGGAGCCTGTCCAAGATGAAGAGACCCCTGCCT

GTGCCGATGAGTTTGACGACTTTGTCACCTATGAG - UNI3676 - GCCAACGAGGTGACAGACAGTGCATATATGGGGTCTGAGAGCACCTACAGTG

AGTGTGAGACCTTCACAGATGAGGACACCAGCACCCTGGTGCACCCCGAGCTGCAGCCTGAAGGGGACGTGGACAGTGCTGGTGGCTCAGGGGTGCCCTC

TGAGTGCCTGGACACCATGGAGGAGCCTGACCATGGTGCATTGCTGCTGCTCCCAGGCAG ATCCCGCCCCCACAGCCAAGCTGTCGTCATGGTGATTGG

CAGTGAGGAACATTTTGAAGATTATGGTGAGGGCAATGAGGCAGAACTATCCCCGGAGACCCTCTGCGATGGGGACGGCGAGGACCCTGCTTTTCTCACC

CCCAG CTCCAACCCTCTTGCCTCAAAGCTGTGCGACGTCCTCACTGACGAGGCCTTTGAGTTTTACTGTAGCCAGTGCCATAAACAGATCAACCGCCTT

GAGGATCTGTCTGCCCGCCTGACTGATCTTGAGATGAATAG CCCAGCCAAGCGGCTCTCCAGCAGGAAGGTGGCAAG GTATCTGCACCAGTCGGGGAC

CCTGACTATGGAGGCCCTGGAGGACCCTCCCCCAGAGCCTGTGGAGTGCCCAGAGGAGGACATTGCAGACAAG GTCATCTTCCTAGAGAGACGGGTGTC

AGAGCTGGAGAAGGACAGTGCAGCTGCTGGCGAGCAGCATGGCAGGCTGAGGCAAGAAAACCTCCAGCTGGTGCACAG AGCCAATGCCTTGGAAGAGCA

GCTGAAGGAACAGGAGTTCAGAGCCCAAGAGAAGGTCCTAGAAGAAACCAGGAAGCAGAAGGAACTTCTGTGCAAGATGGAGCGTGAGAAGAGCATTGAG

ATCGAGAACCTGCAGGCCAG GTTGCAGCAGCTGGATGAGGAGAACAGTGAGCTGCGGTCCTGCACACCCTGTCTGAAGGCCAACATCGAGCGCCTTGAG

GAG GAGAAGCAGAAGATGCTGGATGAGATTGAGGAGTTGACACAGCGGCTCAGTGAGGAACAGGAGAATAAGAGGAAAATGGGGGACAGGCTGAGCCAT

GAGCGGCACCAATTCCAGAGAGACAAGGAAGCAACCCAGGAG CTGATCGAGGACCTCCGCAAGCAGCTAGAACATCTACAGCTCCTCAGACTGGAGGTG

GAGCAGCGACGGGGCCGCAGCAGCAGCCTGGGCCTGCAGGAGTACAACAGCCGTGCACGGGAGAGCGAGCTGGAGCAGGAGGTCCGCAGACTCAAACAG 

GACAACCGTAACCTGAAGGAGCAAAATGATGAGCTAAATGGGCAGATCATCACCCTCAGCATCCAGGGTGCCAAGAGCCTCTTCTCCACGTCTTTCTCAG

AATCACTGGCTGCAGAAATCAGCTCTGTCTCCCGAGATGAG CTCATGGAAGCAATCCAGAAGCAGGAGGAGATCAATTTCCGCCTGCAGGACTACATTG

ACAGGATCATTGTGGCCATCCTGGAGACCAACCCATCCATCCTAGAGGTCAAGTAGTCCATCTTAGCCCAGTTTGGGCTGGTTAGAGACTCCACAGCACC

CAGGAGTGGCCCTGTCTTGCCACAAAGAGCCCGACCAGCAGGTCCTGCAGCTTACCAAGCCCAGGGTGTGTGGGGCCCTCACGCAGTTCGACTGGGAAAA

TACAGAAGGGCTGCAGAGGCAATAAGAAGGAAGAAAGGGAAGTCCACGGCAGGCAAAGGGTGTGGCTGGCTCTCTGAACATCAGGAAACCAGGGCCTCCC

ACCACAAGCCAGCCTCACCAACAACACCATGTCTGCTCAGCAGTATGCAGATATGTGGGGATAGTCTCTCAGGCTGGCATGGGCCCCTTTCTGCTATGCG

CCCTATTAGGAAGAGAGAGAGAGAGAAAGAGAGAGAGAGAGAATGAGTCCTCCCTCAGTTGCTGCCTCTCACTCCTGGTGACATGGTGCCACCCAAGCTT

GGCCATTCCCACATAGTCAGCAAGCTGAGGACCCAAAGTTGGACACAGAAATGGTAGTGTTGGAAAGACAGACAGGCAAAGACGGCACACGTTGGGTCTG

CTTCCAGTCCATAGGCCACCAATTCTCCTTGCGCTGCTCAGGCCTTCTCTCACCAGATGGGCTTCCATTCACCTTCGGACCCAGGGCCTCCAAGCCACAC

AGCTATTCTTTGGCCAGACCCTCACTACAGTAACTCATCAACTCTGGCTCTTGTAGGGGCTGGAGCAGCTAGTTCATGCTGCCTGTGGAACTCACTTCCT

GGACTGATGAGCACGGTCAGCCTCTGTCCCCACTGCAGGTGCTGCTTCTCCTCAGGTGTGGCCTACCTAGGCTCCTGGACCCACACCCTCCTCAGGCTGA

CTTTACTGCCTTGGGAGAAGTCTACATTTCCCAGACAATAGTCTAGGCCTCTGGAACAGTTTCCTTCTCTGCTTTTGACTTTAAATCCCTGGGTGTCCCC

CAGGAGTCAGTTTGCTAGTGGATAATGGAGGAGGTTCTACACTGACCCAGAGGCATAGGAAGGCTTGCTGTCTGCCCTGCACCACCCACAGAGCTGCGGC

ACCCATAGCAGCTGGGCCTGAGCCTGAGCACTAGCCGGAGTCTGGGCACAGTGTCTGAGACCACACCATAGGCTGCGTGAGTGTGAGTGTGTATGGAAGT

GTGTGCGCAAGTGTGTGCGCATGCATGAGTGCGCACACAAGTTTGAGTGTATGAATTCTTGTGCCCACACATGCTGCCCTGCATCCCTTCACTGCCTATC

CCCCTGCCCCCGCCTCACACTACAGTTTAAGATGTTGCCTCGTATTGTACATTTTGGGGAAAGCCTTGTGTGTAAATCAGTGTAAACTTGGAGGAGAGAT

TTTTCTATCATGTAGAGTAGGTATTTTTTATAGATTGAAGGTTGATCAATTTTTTTAATACTTTCCAGAGAGAAAACTATCTGTGTATACATATGAAATA

TATATATATATATATGTATAATATATCAATACTGGAGCCCCGCCTTTCTGTGCCCAGGTCCAGGCCCTGTGTAAGGGCTTGCAGCCTGTCTCTGCTGTCC

ACCCTGCAGTGCTCACTTTAAACACAGGTCTCTAGGAGACCCTGGGAAACACACCAATCACCAACTTGCTCATGACATTGCTTCAGCTCCCTGAGAAGTA

GCTCTTCCTCCAGGGCATGGAAGGATGGGAGGCCAGCAGGACCCTGCCCCATGTGTCAGCTACCACAGATTAAAGCTGTTACCGCACACGGA
Translation
MELCQPTSLSDHDQPASGPQRGVMGLVGPDAPRGWSEEPEEHAQLQRWPEGPNAPICWPEEVEEPHAPSRWAKEPNAPRCSSQEPDESCHLAEELEESDS

PRCWPQEPDTPCHLAKELEEPDAPRCLPQEPDTPCYLAKELEEPNIPRCWPQEPDVPCHLAKELEEPDAPRCWPQEPDAFCHLLKEVEEPDALRCWLQGP

DAPCHLAKELEDLDSPRCWPQEPDESCHLAKELEEPDAPCHLAKELEEPDAPRCWPQEPDVPCLLAKKWEESDAPCLLTEELEEPDALHCWPQESEAPCL

LAKELEEPDASHSCPQEADTGCLSAKEPEEPDVSHLWQGVPDAPCLLVKEPEEADALHCCWPEESEEPDALNPPCFWANEPDEPDPSRCWSEEPQVLCLW

PEEQNTKRCWQEEPDAPCFWPEDREEPIVSCLQFKEPEKPKVRSSWPEELEDCCPTRGLPLEPLLADGELLQACPGPPSDPGPALSLPSEPGTAQEEGAR

LRAVFDALDRDGDGFVRIEDFIQFATVYGAEQ - UNI7802 - - UNI27988 - - UNI29393 - VKDLTQYLDPSGLGVISFEDFYQGIVAIR

NGD - UNI27988 - DPDGQLYSVEPVQDEETPACADEFDDFVTYE - UNI3676 - ANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEG

DVDSAGGSGVPSECLDTMEEPDHGALLLLPGR RSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDPAFLTPS SSNPLASKLCDVLTDEA

FEFYCSQCHKQINRLEDLSARLTDLEMNS SPAKRLSSRKVAR RYLHQSGTLTMEALEDPPPEPVECPEEDIADK VIFLERRVSELEKDSAAAGEQHG

RLRQENLQLVHR RANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQAR RLQQLDEENSELRSCTPCLKANIERLEE EKQKMLDEI

EELTQRLSEEQENKRKMGDRLSHERHQFQRDKEATQE LIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQEVRRLKQ DNRNLKEQN

DELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDE LMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK

For any suggestions or comments, please send an email to unitrap@crg.es