Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037217 (Syn1)
Chromosomal location
Chr X: 20437637 - 20498130 (-)
Description
synapsin I Gene [Source:MGI (curated);Acc:Syn1-001]
RefSeq_peptide
NP_001104250.1 NP_038708.3 
UniGene
Mm.439844 
MGI
MGI:98460 
Uniprot/SWISSPROT
O88935 
Uniprot/SPTREMBL
A2AE14 
Human Ortholog
ENSG00000008056 (SYN1)
Omim 300491 - EPILEPSY, X-LINKED, WITH VARIABLE LEARNING DISABILITIES AND BEHAVIOR  
UniTrap UNI25549
Vector Insertion
Chr X: 20486709 - 20497538
Public Clones not available
Private Clones OST177316 (lexicon) OST126488 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22132
Vector Insertion
Chr X: 20486555 - 20486650
Public Clones not available
Private Clones OST307399 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23397
Vector Insertion
Chr X: 20443035 - 20484202
Public Clones CMHD-GT_453B8-3 (cmhd) (cmhd) IST14108D10 (tigm) IST11531G10 (tigm)
Private Clones OST261123 (lexicon) OST191587 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26151
Vector Insertion
Chr X: 20442388 - 20442971
Public Clones not available
Private Clones OST134184 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27433
Vector Insertion
Chr X: 20442156 - 20442244
Public Clones not available
Private Clones OST59570 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115345
Sequence
AGTCGGACCGCACCACGAGAGGTGCAAGATAGGGAGGTGCGGGCGCGACCATACGCTCTGCGGCGGCAGAGCCTCGGCGCTGCCTCAGTCTGCAGCGGGC

AGCAGAGGAGTCGCGTCGTGCCAGAGAGCACCGCCGTGCTCCTGAGCCCCTCGCGCTCCGCCCCCGCGGCCCACAGACCCACTGCCCCTTGGATCCCCTG

CCCCACGCCGCCACCATGAACTACCTGCGGCGCCGCCTGTCGGACAGCAACTTCATGGCCAATCTGCCGAATGGGTACATGACAGACCTGCAGCGCCCGC

AACCGCCCCCGCCGCCTCCCTCGGCCGCCAGCCCTGGGGCCACGCCCGGCTCCGCGACAGCCTCTGCCGAGAGGGCCTCCACAGCTGCTCCAGTGGCTTC

TCCAGCAGCCCCTAGTCCTGGGTCCTCGGGGGGCGGCGGCTTCTTCTCGTCGCTGTCTAACGCGGTCAAGCAAACCACAGCAGCCGCAGCCGCCACCTTC

AGCGAGCAGGTGGGCGGTGGCTCTGGGGGCGCAGGCCGCGGGGGCGCCGCCGCCAGGGTGCTGCTGGTCATCGACGAACCGCACACCGACTG - UNI25

549 - GGCAAAATACTTCAAAGGGAAGAAGATCCATGGAGAAATTGACATTAAAGTAGAGCAA - UNI22132 - GCTGAATTCTCTGATCTCAATC

TTGTGGCTCATGCCAATGGTGGATTCTCTGTGGACATGGAAGTTCTTCGGAATGGAGTCAAAGTTGTGAG GTCTCTGAAGCCAGACTTTGTGCTGATCC

GCCAGCATGCCTTCAGCATGGCACGTAATGGAGACTACCGAAGTTTGGTCATTGGGCTGCAGTATGCTGGAATCCCCAGTGTAAACTCTTTGCATTCTGT

CTACAACTTCTGTGACAAACCCTGGGTG TTTGCCCAGATGGTTCGACTACACAAGAAGCTTGGAACAGAGGAATTCCCTCTGATTGATCAGACTTTCTA

TCCTAATCACAAAGAGATG - UNI23397 - CTCAGCAGCACAACATACCCTGTGGTTGTGAAGATGGGCCACGCACATTCTGGGATGGGCAAG - U

NI26151 - GTCAAGGTAGACAACCAACATGACTTCCAGGATATTGCAAGTGTTGTGGCACTGACTAAGACATATGCCACTGCTGAGCCCTTCATTGAT

GCTAAATATGATGTGCGTGTCCAGAAGATTGGGCAGAACTACAAGGCCTACAT - UNI27433 - GAGGACATCAGTGTCGGGTAACTGGAAGACCAA

TACAGGTTCTGCTATGCTTGAGCAGATTGCCATGTCTGACAG GTACAAGTTGTGGGTAGACACGTGCTCAGAGATTTTTGGGGGACTTGACATCTGCGC

AGTGGAAGCGCTGCATGGCAAGGACGGAAGGGATCACATTATTGAG GTGGTGGGCTCCTCCATGCCACTCATTGGTGATCACCAGGATGAAGACAAGCA

GCTCATCGTGGAACTTGTGGTCAACAAGATGACTCAGGCTCTGCCTCGGCAGCCGCAGCGGGATGCTTCCCCTGGCAGGGGCTCCCACAGCCAG TCTTC

ATCCCCAGGAGCCCTGACCTTGGGCCGCCAGACCTCCCAGCAGCCTGCAGGTCCTCCTGCTCAACAACGACCCCCACCCCAGG GAGGCCCTCCACAGCC

AGGCCCAGGACCTCAGCGCCAGGGACCCCCGCTGCAGCAGCGCCCACCCCCACAAGGCCAGCAACATCTTTCTGGCCTTGGACCGCCAGCTGGCAGCCCT

CTGCCTCAGCGCCTACCAAGTCCCACCGCAGCACCTCAGCAGTCTGCCTCTCAGGCCACACCAGTGACCCAGGGTCAAGGCCGCCAGTCGCGGCCAGTGG

CAGGAGGCCCTGGAGCACCTCCAGCAGCGCGCCCACCAGCCTCCCCATCTCCACAGCGTCAGGCGGGGGCCCCGCAGGCTACCCGTCAGGCATCTATCTC

TGGTCCAGCTCCAACGAAGGCCTCAGGAGCCCCACCCGGAGGGCAGCAGCGCCAGGGCCCTCCCCAAAAACCCCCAGGCCCTGCTGGTCCCACTCGTCAG

GCCAGTCAGGCAGGTCCCGGACCTCGCACTGGGCCTCCCACCACACAGCAGCCCCGGCCCAGCGGCCCAGGTCCTGCTGGACGTCCCGCCAAACCACAGC

TGGCCCAGAAACCCAGCCAGGATGTGCCACCACCCATCACCGCCGCTGCCGGGGGACCCCCGCACCCCCAGCTCAA AGCCAGCCCCTCCCAGGCCCAGC

CTTAGCCAGGACGAGGTGAAAGCTGAGACCATCCGCAGCCTGAGGAAGTCTTTCGCCAGCCTCTTCTCCGACTGACATCCCACTCTGAGAACCCCTAAAC

CCCTAGACAGCCCTCTCTGGGTCCTGAGTCCATTTCTCACTTTTGGAACCTCCAAATCCCTTGAGAACCCCTCTCCTGGTTCTCCTAGAGCCCACTTCTC

ATTCCTCAGTATGTCCCTTGAGAAACCTGGTCCTAAATCCAGTTCTCACATTTGGGAATCCCCAAGTCCATTTAGAATCCTGTTCCTGGTCACCTCCAGA

TCTGTTTGAGAACCTCCAAACTCCTGAAGACCTCTACTTCTGGTACATCTAAAGGGTGATTTCTTCCCTGAAAGTTCCTGAATGGCAGAAAACCTGTTTC

TGACCTAATACATCGAATCCTCTCCTGGAGCTCTGAAATTCCTGAAAAACCCTATTCTACTCTTGGTCCTGAATCTCTCCAACACACCTTGCTCCTAATC

AGAAATTTCCAATTCCATAAGAAGCCCCTATCCTTAAACCTCTTCCATAGGTCATCTCTCTGGAGATCCACATCTTCAAATGCCACCTACCATCCACCAA

GCAGTCCCTCAAGGACTTCCCTTCACCTCTTCCTCTCCATCCCATTCAATATACTGGAAGTTCCTTCCACTTCTAGGACCCCTAAGTTCCCTCCTCCAGA

AACCCCTCCCCAATTTCCTGCCTCTGACAGCTGTCTTTAAATATGCAAACTCCACCCATCCTCAGAATCCTTTGCACAAGGAAGGCCTGTGGTCTCCCAC

TCCCCTACCTTTGCCAATGTGTTTATCTGTGACTGACTTGGCCTCCTTTTGTGCCATGCTTGGCATATGTGGTCCTCATTCATGCCGCCTGTGGTAATGC

GTACAGTGGCACTGTTTTTGTGGTCTGCATCTTCCTCCAACCTCCACTCCTTGCCTGGACTTGCCCCACCCCTCAGCGGCTCTGAACCCCCAAGAGAAGA

GTCGGGAAGCAAAATAAACAAGCAAAGGCCCAGCAGAA
Translation
MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPSAASPGATPGSATASAERASTAAPVASPAAPSPGSSGGGGFFSSLSNAVKQTTAAAAATFSEQVG

GGSGGAGRGGAAARVLLVIDEPHTDW - UNI25549 - WAKYFKGKKIHGEIDIKVEQ - UNI22132 - AEFSDLNLVAHANGGFSVDMEVLRNG

VKVVR RSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWV FAQMVRLHKKLGTEEFPLIDQTFYPNHKEM - UNI2339

7 - LSSTTYPVVVKMGHAHSGMGK - UNI26151 - VKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYM - UNI27433 -

 MRTSVSGNWKTNTGSAMLEQIAMSDR RYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIE VVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPRQP

QRDASPGRGSHSQ SSSPGALTLGRQTSQQPAGPPAQQRPPPQG GGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSPTAAPQQSA

SQATPVTQGQGRQSRPVAGGPGAPPAARPPASPSPQRQAGAPQATRQASISGPAPTKASGAPPGGQQRQGPPQKPPGPAGPTRQASQAGPGPRTGPPTTQ

QPRPSGPGPAGRPAKPQLAQKPSQDVPPPITAAAGGPPHPQLK KASPSQAQP
Transcript ENSMUST00000041344
Sequence
AGTCGCGTCGTGCCAGAGAGCACCGCCGTGCTCCTGAGCCCCTCGCGCTCCGCCCCCGCGGCCCACAGACCCACTGCCCCTTGGATCCCCTGCCCCACGC

CGCCACCATGAACTACCTGCGGCGCCGCCTGTCGGACAGCAACTTCATGGCCAATCTGCCGAATGGGTACATGACAGACCTGCAGCGCCCGCAACCGCCC

CCGCCGCCTCCCTCGGCCGCCAGCCCTGGGGCCACGCCCGGCTCCGCGACAGCCTCTGCCGAGAGGGCCTCCACAGCTGCTCCAGTGGCTTCTCCAGCAG

CCCCTAGTCCTGGGTCCTCGGGGGGCGGCGGCTTCTTCTCGTCGCTGTCTAACGCGGTCAAGCAAACCACAGCAGCCGCAGCCGCCACCTTCAGCGAGCA

GGTGGGCGGTGGCTCTGGGGGCGCAGGCCGCGGGGGCGCCGCCGCCAGGGTGCTGCTGGTCATCGACGAACCGCACACCGACTG - UNI25549 - GG

CAAAATACTTCAAAGGGAAGAAGATCCATGGAGAAATTGACATTAAAGTAGAGCAA - UNI22132 - GCTGAATTCTCTGATCTCAATCTTGTGGCT

CATGCCAATGGTGGATTCTCTGTGGACATGGAAGTTCTTCGGAATGGAGTCAAAGTTGTGAG GTCTCTGAAGCCAGACTTTGTGCTGATCCGCCAGCAT

GCCTTCAGCATGGCACGTAATGGAGACTACCGAAGTTTGGTCATTGGGCTGCAGTATGCTGGAATCCCCAGTGTAAACTCTTTGCATTCTGTCTACAACT

TCTGTGACAAACCCTGGGTG TTTGCCCAGATGGTTCGACTACACAAGAAGCTTGGAACAGAGGAATTCCCTCTGATTGATCAGACTTTCTATCCTAATC

ACAAAGAGATG - UNI23397 - CTCAGCAGCACAACATACCCTGTGGTTGTGAAGATGGGCCACGCACATTCTGGGATGGGCAAG - UNI26151 

- GTCAAGGTAGACAACCAACATGACTTCCAGGATATTGCAAGTGTTGTGGCACTGACTAAGACATATGCCACTGCTGAGCCCTTCATTGATGCTAAATA

TGATGTGCGTGTCCAGAAGATTGGGCAGAACTACAAGGCCTACAT - UNI27433 - GAGGACATCAGTGTCGGGTAACTGGAAGACCAATACAGGTT

CTGCTATGCTTGAGCAGATTGCCATGTCTGACAG GTACAAGTTGTGGGTAGACACGTGCTCAGAGATTTTTGGGGGACTTGACATCTGCGCAGTGGAAG

CGCTGCATGGCAAGGACGGAAGGGATCACATTATTGAG GTGGTGGGCTCCTCCATGCCACTCATTGGTGATCACCAGGATGAAGACAAGCAGCTCATCG

TGGAACTTGTGGTCAACAAGATGACTCAGGCTCTGCCTCGGCAGCCGCAGCGGGATGCTTCCCCTGGCAGGGGCTCCCACAGCCAG TCTTCATCCCCAG

GAGCCCTGACCTTGGGCCGCCAGACCTCCCAGCAGCCTGCAGGTCCTCCTGCTCAACAACGACCCCCACCCCAGG GAGGCCCTCCACAGCCAGGCCCAG

GACCTCAGCGCCAGGGACCCCCGCTGCAGCAGCGCCCACCCCCACAAGGCCAGCAACATCTTTCTGGCCTTGGACCGCCAGCTGGCAGCCCTCTGCCTCA

GCGCCTACCAAGTCCCACCGCAGCACCTCAGCAGTCTGCCTCTCAGGCCACACCAGTGACCCAGGGTCAAGGCCGCCAGTCGCGGCCAGTGGCAGGAGGC

CCTGGAGCACCTCCAGCAGCGCGCCCACCAGCCTCCCCATCTCCACAGCGTCAGGCGGGGGCCCCGCAGGCTACCCGTCAGGCATCTATCTCTG GTCCC

ACTCGTCAGGCCAGTCAGGCAGGTCCCGGACCTCGCACTGGGCCTCCCACCACACAGCAGCCCCGGCCCAGCGGCCCAGGTCCTGCTGGACGTCCCGCCA

AACCACAGCTGGCCCAGAAACCCAGCCAGGATGTGCCACCACCCATCACCGCCGCTGCCGGGGGACCCCCGCACCCCCAGCTCAA CAAATCCCAGTCTC

TGACCAATGCCTTCAACCTTCCAGAGCCAGCCCCTCCCAGGCCCAGCCTTAGCCAGGACGAGGTGAAAGCTGAGACCATCCGCAGCCTGAGGAAGTCTTT

CGCCAGCCTCTTCTCCGACTGACATCCCACTCTGAGAACCCCTAAACCCCTAGACAGCCCTCTCTGGGTCCTGAGTCCATTTCTCACTTTTGGAACCTCC

AAATCCCTTGAGAACCCCTCTCCTGGTTCTCCTAGAGCCCACTTCTCATTCCTCAGTATGTCCCTTGAGAAACCTGGTCCTAAATCCAGTTCTCACATTT

GGGAATCCCCAAGTCCATTTAGAATCCTGTTCCTGGTCACCTCCAGATCTGTTTGAGAACCTCCAAACTCCTGAAGACCTCTACTTCTGGTACATCTAAA

GGGTGATTTCTTCCCTGAAAGTTCCTGAATGGCAGAAAACCTGTTTCTGACCTAATACATCGAATCCTCTCCTGGAGCTCTGAAATTCCTGAAAAACCCT

ATTCTACTCTTGGTCCTGAATCTCTCCAACACACCTTGCTCCTAATCAGAAATTTCCAATTCCATAAGAAGCCCCTATCCTTAAACCTCTTCCATAGGTC

ATCTCTCTGGAGATCCACATCTTCAAATGCCACCTACCATCCACCAAGCAGTCCCTCAAGGACTTCCCTTCACCTCTTCCTCTCCATCCCATTCAATATA

CTGGAAGTTCCTTCCACTTCTAGGACCCCTAAGTTCCCTCCTCCAGAAACCCCTCCCCAATTTCCTGCCTCTGACAGCTGTCTTTAAATATGCAAACTCC

ACCCATCCTCAGAATCCTTTGCACAAGGAAGGCCTGTGGTCTCCCACTCCCCTACCTTTGCCAATGTGTTTATCTGTGACTGACTTGGCCTCCTTTTGTG

CCATGCTTGGCATATGTGGTCCTCATTCATGCCGCCTGTGGTAATGCGTACAGTGGCACTGTTTTTGTGGTCTGCATCTTCCTCCAACCTCCACTCCTTG

CCTGGACTTGCCCCACCCCTCAGCGGCTCTGAACCCCCAAGAGAAGAGTCGGGAAGCAAAATAAACAAGCAAAGGCCCAGC
Translation
MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPSAASPGATPGSATASAERASTAAPVASPAAPSPGSSGGGGFFSSLSNAVKQTTAAAAATFSEQVG

GGSGGAGRGGAAARVLLVIDEPHTDW - UNI25549 - WAKYFKGKKIHGEIDIKVEQ - UNI22132 - AEFSDLNLVAHANGGFSVDMEVLRNG

VKVVR RSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWV FAQMVRLHKKLGTEEFPLIDQTFYPNHKEM - UNI2339

7 - LSSTTYPVVVKMGHAHSGMGK - UNI26151 - VKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYM - UNI27433 -

 MRTSVSGNWKTNTGSAMLEQIAMSDR RYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIE VVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPRQP

QRDASPGRGSHSQ SSSPGALTLGRQTSQQPAGPPAQQRPPPQG GGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSPTAAPQQSA

SQATPVTQGQGRQSRPVAGGPGAPPAARPPASPSPQRQAGAPQATRQASISG GPTRQASQAGPGPRTGPPTTQQPRPSGPGPAGRPAKPQLAQKPSQDV

PPPITAAAGGPPHPQLN NKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD
Transcript ENSMUST00000081893
Sequence
AGTCGCGTCGTGCCAGAGAGCACCGCCGTGCTCCTGAGCCCCTCGCGCTCCGCCCCCGCGGCCCACAGACCCACTGCCCCTTGGATCCCCTGCCCCACGC

CGCCACCATGAACTACCTGCGGCGCCGCCTGTCGGACAGCAACTTCATGGCCAATCTGCCGAATGGGTACATGACAGACCTGCAGCGCCCGCAACCGCCC

CCGCCGCCTCCCTCGGCCGCCAGCCCTGGGGCCACGCCCGGCTCCGCGACAGCCTCTGCCGAGAGGGCCTCCACAGCTGCTCCAGTGGCTTCTCCAGCAG

CCCCTAGTCCTGGGTCCTCGGGGGGCGGCGGCTTCTTCTCGTCGCTGTCTAACGCGGTCAAGCAAACCACAGCAGCCGCAGCCGCCACCTTCAGCGAGCA

GGTGGGCGGTGGCTCTGGGGGCGCAGGCCGCGGGGGCGCCGCCGCCAGGGTGCTGCTGGTCATCGACGAACCGCACACCGACTG - UNI25549 - GG

CAAAATACTTCAAAGGGAAGAAGATCCATGGAGAAATTGACATTAAAGTAGAGCAA - UNI22132 - GCTGAATTCTCTGATCTCAATCTTGTGGCT

CATGCCAATGGTGGATTCTCTGTGGACATGGAAGTTCTTCGGAATGGAGTCAAAGTTGTGAG GTCTCTGAAGCCAGACTTTGTGCTGATCCGCCAGCAT

GCCTTCAGCATGGCACGTAATGGAGACTACCGAAGTTTGGTCATTGGGCTGCAGTATGCTGGAATCCCCAGTGTAAACTCTTTGCATTCTGTCTACAACT

TCTGTGACAAACCCTGGGTG TTTGCCCAGATGGTTCGACTACACAAGAAGCTTGGAACAGAGGAATTCCCTCTGATTGATCAGACTTTCTATCCTAATC

ACAAAGAGATG - UNI23397 - CTCAGCAGCACAACATACCCTGTGGTTGTGAAGATGGGCCACGCACATTCTGGGATGGGCAAG - UNI26151 

- GTCAAGGTAGACAACCAACATGACTTCCAGGATATTGCAAGTGTTGTGGCACTGACTAAGACATATGCCACTGCTGAGCCCTTCATTGATGCTAAATA

TGATGTGCGTGTCCAGAAGATTGGGCAGAACTACAAGGCCTACAT - UNI27433 - GAGGACATCAGTGTCGGGTAACTGGAAGACCAATACAGGTT

CTGCTATGCTTGAGCAGATTGCCATGTCTGACAG GTACAAGTTGTGGGTAGACACGTGCTCAGAGATTTTTGGGGGACTTGACATCTGCGCAGTGGAAG

CGCTGCATGGCAAGGACGGAAGGGATCACATTATTGAG GTGGTGGGCTCCTCCATGCCACTCATTGGTGATCACCAGGATGAAGACAAGCAGCTCATCG

TGGAACTTGTGGTCAACAAGATGACTCAGGCTCTGCCTCGGCAGCCGCAGCGGGATGCTTCCCCTGGCAGGGGCTCCCACAGCCAG TCTTCATCCCCAG

GAGCCCTGACCTTGGGCCGCCAGACCTCCCAGCAGCCTGCAGGTCCTCCTGCTCAACAACGACCCCCACCCCAGG GAGGCCCTCCACAGCCAGGCCCAG

GACCTCAGCGCCAGGGACCCCCGCTGCAGCAGCGCCCACCCCCACAAGGCCAGCAACATCTTTCTGGCCTTGGACCGCCAGCTGGCAGCCCTCTGCCTCA

GCGCCTACCAAGTCCCACCGCAGCACCTCAGCAGTCTGCCTCTCAGGCCACACCAGTGACCCAGGGTCAAGGCCGCCAGTCGCGGCCAGTGGCAGGAGGC

CCTGGAGCACCTCCAGCAGCGCGCCCACCAGCCTCCCCATCTCCACAGCGTCAGGCGGGGGCCCCGCAGGCTACCCGTCAGGCATCTATCTCTGGTCCAG

CTCCAACGAAGGCCTCAGGAGCCCCACCCGGAGGGCAGCAGCGCCAGGGCCCTCCCCAAAAACCCCCAGGCCCTGCTGGTCCCACTCGTCAGGCCAGTCA

GGCAGGTCCCGGACCTCGCACTGGGCCTCCCACCACACAGCAGCCCCGGCCCAGCGGCCCAGGTCCTGCTGGACGTCCCGCCAAACCACAGCTGGCCCAG

AAACCCAGCCAGGATGTGCCACCACCCATCACCGCCGCTGCCGGGGGACCCCCGCACCCCCAGCTCAA CAAATCCCAGTCTCTGACCAATGCCTTCAAC

CTTCCAGAGCCAGCCCCTCCCAGGCCCAGCCTTAGCCAGGACGAGGTGAAAGCTGAGACCATCCGCAGCCTGAGGAAGTCTTTCGCCAGCCTCTTCTCCG

ACTGACATCCCACTCTGAGAACCCCTAAACCCCTAGACAGCCCTCTCTGGGTCCTGAGTCCATTTCTCACTTTTGGAACCTCCAAATCCCTTGAGAACCC

CTCTCCTGGTTCTCCTAGAGCCCACTTCTCATTCCTCAGTATGTCCCTTGAGAAACCTGGTCCTAAATCCAGTTCTCACATTTGGGAATCCCCAAGTCCA

TTTAGAATCCTGTTCCTGGTCACCTCCAGATCTGTTTGAGAACCTCCAAACTCCTGAAGACCTCTACTTCTGGTACATCTAAAGGGTGATTTCTTCCCTG

AAAGTTCCTGAATGGCAGAAAACCTGTTTCTGACCTAATACATCGAATCCTCTCCTGGAGCTCTGAAATTCCTGAAAAACCCTATTCTACTCTTGGTCCT

GAATCTCTCCAACACACCTTGCTCCTAATCAGAAATTTCCAATTCCATAAGAAGCCCCTATCCTTAAACCTCTTCCATAGGTCATCTCTCTGGAGATCCA

CATCTTCAAATGCCACCTACCATCCACCAAGCAGTCCCTCAAGGACTTCCCTTCACCTCTTCCTCTCCATCCCATTCAATATACTGGAAGTTCCTTCCAC

TTCTAGGACCCCTAAGTTCCCTCCTCCAGAAACCCCTCCCCAATTTCCTGCCTCTGACAGCTGTCTTTAAATATGCAAACTCCACCCATCCTCAGAATCC

TTTGCACAAGGAAGGCCTGTGGTCTCCCACTCCCCTACCTTTGCCAATGTGTTTATCTGTGACTGACTTGGCCTCCTTTTGTGCCATGCTTGGCATATGT

GGTCCTCATTCATGCCGCCTGTGGTAATGCGTACAGTGGCACTGTTTTTGTGGTCTGCATCTTCCTCCAACCTCCACTCCTTGCCTGGACTTGCCCCACC

CCTCAGCGGCTCTGAACCCCCAAGAGAAGAGTCGGGAAGCAAAATAAACAAGCAAAGGCCCAGC
Translation
MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPSAASPGATPGSATASAERASTAAPVASPAAPSPGSSGGGGFFSSLSNAVKQTTAAAAATFSEQVG

GGSGGAGRGGAAARVLLVIDEPHTDW - UNI25549 - WAKYFKGKKIHGEIDIKVEQ - UNI22132 - AEFSDLNLVAHANGGFSVDMEVLRNG

VKVVR RSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWV FAQMVRLHKKLGTEEFPLIDQTFYPNHKEM - UNI2339

7 - LSSTTYPVVVKMGHAHSGMGK - UNI26151 - VKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYM - UNI27433 -

 MRTSVSGNWKTNTGSAMLEQIAMSDR RYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIE VVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPRQP

QRDASPGRGSHSQ SSSPGALTLGRQTSQQPAGPPAQQRPPPQG GGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPAGSPLPQRLPSPTAAPQQSA

SQATPVTQGQGRQSRPVAGGPGAPPAARPPASPSPQRQAGAPQATRQASISGPAPTKASGAPPGGQQRQGPPQKPPGPAGPTRQASQAGPGPRTGPPTTQ

QPRPSGPGPAGRPAKPQLAQKPSQDVPPPITAAAGGPPHPQLN NKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD

For any suggestions or comments, please send an email to unitrap@crg.es