Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037221 (Mospd3)
Chromosomal location
Chr 5: 138037873 - 138042272 (-)
Description
motile sperm domain containing 3 Gene [Source:MGI (curated);Acc:Mospd3-001]
RefSeq_dna
NM_030037 
RefSeq_peptide
NP_084313.1 
UniGene
Mm.41355 
MGI
MGI:1916179 
Uniprot/SWISSPROT
Q8BGG6 
Uniprot/SPTREMBL
Q05DT5 
Human Ortholog
ENSG00000106330 (MOSPD3)
Omim not available
UniTrap UNI34123
Vector Insertion
Chr 5: 138041498 - 138042273
Public Clones IST10911H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13008
Vector Insertion
Chr 5: 138038544 - 138040821
Public Clones CMHD-GT_532B9-5S (cmhd) CMHD-GT_511F7-3 (cmhd) CMHD-GT_354G3-3 (cmhd) IST14795H1 (tigm)
IST14833D2 (tigm) IST14793A5 (tigm) IST13152H3 (tigm) IST14483B1 (tigm)
Private Clones OST127317 (lexicon) OST25298 (lexicon) OST22099 (lexicon) OST5452 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13981
Vector Insertion
Chr 5: 138038282 - 138038378
Public Clones CMHD-GT_114D10-3 (cmhd) CMHD-GT_180C7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30137
Vector Insertion
Chr 5: 138037883 - 138038544
Public Clones D105E11 (ggtc) IST14793A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037620
Sequence
AGATGGCGCCCTTAATTTGGTCACAAGTTGACCGGAGGAAACTTTGACCGCGAGGTGATTATCACAGTACAAGCGGCTGTTCACAGGCGGGATCCCGAGC

AGAGCATATGCCGAGCTCAAGGAAAGGGCACAGGGACACAATTCGGTGACCTGGAGGTCAGGGACTCTCAAAGAGCAGAGTCCGTCAGGAGATCGGAGCG

GGAAGACCCGGAAAAGGCGTGGTCAGAAACAGGGCGGGTTTACTGCGCCCCAAACCGGAAGACCCGGATTGGGAAGCGACGAGGCGGGACGGATTTTAGC

CAG - UNI34123 - CCCTAAACTCTAAGACCCTCTTGTCCTCCTGAGCTCTGCCCTCGGATGTCCGACCGCCCAGAGCCTGCATGCGCCGTGGGGCG

CCCCAGGACCAGGAGCTGGTGGGTCCGGGGGCCCCTGGGCGGGGGTCCCGGGGCTCCCCTCCTTCCTCAGGACCCGTTGTCCCGGTGCTGGTCTTTCCCC

CGGATCTAGTATTCAGGGCGGACCAGAGAAGTGGACCCCGGCAGCTGCTGACCCTCTACAACCCCACGGGAACTGCGCTTCGCTTCCGAG - UNI3412

3 - TTCTGTGCACAGCACCTGCCAAATACACGGTATTCGATGCAGAGGGATATGTGAAGCCTCAGTCCTGCATTGACAT TGTGATACGGCACGTGGCC

CCCGTCCCCAGCCACTATGACGTCCAGGACAGATTCCGCATTGAGCTGTCTGAGGAGGGGACTGAGGGACGAGTGGTTGGAAGAAAAGACATCACCTCTG

TTCTTCGAGCCCCAGCGTACCCCCTGGAGCTTCAGGGACATTCTGAGCCAACGCCCAACCCAGGGCCTCCTGTGTGGACAGGACTGACCCCAGCCAGACA

TCTTCAGGAGA - UNI13008 - - UNI30137 - ATGCCCCCCAGCAGCTGGCCACCAGCTCCTTCCTGCTCTTCTTGCTGGCAGGCGTCATCTCT

GTGGCCTTCCTGCTCCTACCACTGCAGGATGAGCTTGGCAGCCAGCTGCCTCAAGTCCTGCACGTGTCCCTGGGACAGAAGCTGGTTGCGGCCTACGTCT

TAG - UNI13981 - - UNI30137 - GCCTCCTCACCATGGTGCTCCTCCGGACCTGAACTCTCAGCTGAACCCACCTCACCCACCCTCTCCTTCG

CAGGCAGGGACCTAAGGCAGCCACTGTGATGTTTGCACCTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCC

GTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGTTTCCGCCCATCCGTTGCTC

CTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGATTGTCAGCCTCCCCACAGCAAGCACCTGGGATTTGTACTC

ATTTTCCAAGTTGATTAAAATACATTTT
Translation
 - UNI34123 - MRRGAPQDQELVGPGAPGRGSRGSPPSSGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRV - UNI34123 - VLC

TAPAKYTVFDAEGYVKPQSCIDI IVIRHVAPVPSHYDVQDRFRIELSEEGTEGRVVGRKDITSVLRAPAYPLELQGHSEPTPNPGPPVWTGLTPARHLQ

EN - UNI13008 - - UNI30137 - NAPQQLATSSFLLFLLAGVISVAFLLLPLQDELGSQLPQVLHVSLGQKLVAAYVLG - UNI13981 - -

 UNI30137 - GLLTMVLLRT
Transcript ENSMUST00000111007
Sequence
GGGGCCTATAGGAACCTGGGGCCCAGCTGGCAGGAGAGGAGGTTTGGGAACCGGGGCCCGGGGCTGCAGGATCCACATCTAGCGGGGTTCCAAGGCAGTG

GTGACATCAGGCCTCGCTCTGCTCATGATCTCCCCCTGTCCTCTTTTCATCCATCGCGTCACTAGCCCTAAACTCTAAGACCCTCTTGTCCTCCTGAGCT

CTGCCCTCGGATGTCCGACCGCCCAGAGCCTGCATGCGCCGTGGGGCGCCCCAGGACCAGGAGCTGGTGGGTCCGGGGGCCCCTGGGCGGGGGTCCCGGG

GCTCCCCTCCTTCCTCAGGACCCGTTGTCCCGGTGCTGGTCTTTCCCCCGGATCTAGTATTCAGGGCGGACCAGAGAAGTGGACCCCGGCAGCTGCTGAC

CCTCTACAACCCCACGGGAACTGCGCTTCGCTTCCGAG - UNI34123 - TTCTGTGCACAGCACCTGCCAAATACACGGTATTCGATGCAGAGGGAT

ATGTGAAGCCTCAGTCCTGCATTGACAT TGTGATACGGCACGTGGCCCCCGTCCCCAGCCACTATGACGTCCAGGACAGATTCCGCATTGAGCTGTCTG

AGGAGGGGACTGAGGGACGAGTGGTTGGAAGAAAAGACATCACCTCTGTTCTTCGAGCCCCAGCGTACCCCCTGGAGCTTCAGGGACATTCTGAGCCAAC

GCCCAACCCAGGGCCTCCTGTGTGGACAGGACTGACCCCAGCCAGACATCTTCAGGAGA - UNI13008 - - UNI30137 - ATGCCCCCCAGCAG

CTGGCCACCAGCTCCTTCCTGCTCTTCTTGCTGGCAGGCGTCATCTCTGTGGCCTTCCTGCTCCTACCACTGCAGGATGAGCTTGGCAGCCAGCTGCCTC

AAGTCCTGCACGTGTCCCTGGGACAGAAGCTGGTTGCGGCCTACGTCTTAG - UNI13981 - - UNI30137 - GCCTCCTCACCATGGTGCTCCT

CCGGACCTGAACTCTCAGCTGAACCCACCTCACCCACCCTCTCCTTCGCAGGCAGGGACCTAAGGCAGCCACTGTGATGTTTGCACCTTGCTCCTCCTCC

CTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTT

CCGCCCATCCGTTGCTCCTCCTCCCTCGTTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCATCCGTTGCTCCTCCTCCCTCGCTTCCGCCCA

TCCGTTGATTGTCAGCCTCCCCACAGCAAGCACCTGGGATTTGTACTCATTTTCCAAGTTGATTAAAATACATTTTAAAAATCAAAA
Translation
MRRGAPQDQELVGPGAPGRGSRGSPPSSGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRV - UNI34123 - VLCTAPAKYTVFDAEGY

VKPQSCIDI IVIRHVAPVPSHYDVQDRFRIELSEEGTEGRVVGRKDITSVLRAPAYPLELQGHSEPTPNPGPPVWTGLTPARHLQEN - UNI13008 

- - UNI30137 - NAPQQLATSSFLLFLLAGVISVAFLLLPLQDELGSQLPQVLHVSLGQKLVAAYVLG - UNI13981 - - UNI30137 - GL

LTMVLLRT

For any suggestions or comments, please send an email to unitrap@crg.es