Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037224 (Zfyve28)
Chromosomal location
Chr 5: 34537521 - 34631098 (-)
Description
zinc finger, FYVE domain containing 28 Gene [Source:MGI (curated);Acc:Zfyve28-001]
RefSeq_dna
NM_001015039 
RefSeq_peptide
NP_001015039.1 
UniGene
Mm.113388 
MGI
MGI:2684992 
Uniprot/SPTREMBL
B2RSX8 Q8CG84 Q6ZPK7 
Human Ortholog
ENSG00000159733 (ZFYVE28)
Omim not available
UniTrap UNI21801
Vector Insertion
Chr 5: 34585821 - 34585963
Public Clones not available
Private Clones OST317455 (lexicon) OST283256 (lexicon) OST34162 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34181
Vector Insertion
Chr 5: 34585821 - 34630976
Public Clones IST13318G10 (tigm) IST12859H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26072
Vector Insertion
Chr 5: 34578808 - 34585821
Public Clones not available
Private Clones OST140094 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23747
Vector Insertion
Chr 5: 34576044 - 34576933
Public Clones not available
Private Clones OST246182 (lexicon) OST236510 (lexicon) OST139158 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114368
Sequence
GGAGGCGCTGGGTGCTCTTAAGCCGTGAAGCACCGCGCGCCCTGTGCCCGCGCCTTTCCGCGCGCCCGCCCGCTCGCGGGTTTGGGTCGGCCGCGCGCCG

CTTGCTGAGCATCCTTCCGGCCGCGCACCTGCCCCGCGCACCTGCAGCCAGCTGCTCGGCGCTAGGCGCCGCGCACACGATCTGCTTGCTCAAGCAGGTC

CCGGCCCTGCCTGCGTGTCCACCCCGCGCCGCAGCCGGACCCGGGCGCAGCGCTGCAGAGGGCGAGGGCCGCCCGGAGCGTGGCTCGGGCCGGCGCGGCG

ATGATGAACAGATTCCGAAAGTGGCTGTACAAACCCAAG - UNI21801 - - UNI34181 - AGGTCAGACCCACAACTGCTGGCCCAGTTCTACT

ATGCTGATGAGGAGCTGAACCAGGTGGCTGCAGAGCTGGACAGCCTGGATGGGCGGAAGGAGCCCCAGAGGTGCACACTGCTTGTCAGCCAGTTCCGCTC

CTGTCAG - UNI21801 - - UNI26072 - - UNI34181 - TCTTTCTTTCTGTTTCAGGACAATGTATTAAACATCATTAATCAGATCATGGA

GGAGTGTATCCCTCAGGACCGTGCCCCTCGGGATTTCTGCGTCAAGTTTCCAGAGGAGATCCGGCATGACAACTTGGCTGGCCAGCTGTGGTTCGGGGCT

GAG TGCCTGGCAGCTGGCTCCATCATCATGAATCGGGAGCTGGAGAGCATGGCCATGCGGCCACTGGCCAAGGAGCTGA
Translation
MMNRFRKWLYKPK - UNI21801 - - UNI34181 - RSDPQLLAQFYYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQ - UNI21801 -

 - UNI26072 - - UNI34181 - SFFLFQDNVLNIINQIMEECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAE CLAAGSIIMNRELESMAMRP

LAKEL
Transcript ENSMUST00000114369
Sequence
GTCGTGACCGGCGGAGGCGCTGGGTGCTCTTAAGCCGTGAAGCACCGCGCGCCCTGTGCCCGCGCCTTTCCGCGCGCCCGCCCGCTCGCGGGTTTGGGTC

GGCCGCGCGCCGCTTGCTGAGCATCCTTCCGGCCGCGCACCTGCCCCGCGCACCTGCAGCCAGCTGCTCGGCGCTAGGCGCCGCGCACACGATCTGCTTG

CTCAAGCAGGTCCCGGCCCTGCCTGCGTGTCCACCCCGCGCCGCAGCCGGACCCGGGCGCAGCGCTGCAGAGGGCGAGGGCCGCCCGGAGCGTGGCTCGG

GCCGGCGCGGCGATGATGAACAGATTCCGAAAGTGGCTGTACAAACCCAAG - UNI21801 - - UNI26072 - - UNI34181 - GACAATGTA

TTAAACATCATTAATCAGATCATGGAGGAGTGTATCCCTCAGGACCGTGCCCCTCGGGATTTCTGCGTCAAGTTTCCAGAGGAGATCCGGCATGACAACT

TGGCTGGCCAGCTGTGGTTCGGGGCTGAG TGCCTGGCAGCTGGCTCCATCATCATGAATCGGGAGCTGGAGAGCATGGCCATGCGGCCACTGGCCAAGG

AGCTGACACGCAGCCTGGAGGACGTGCGGGGCACTCTCCGTGACCAGGCACTCCGAGACCTCAACACTTACACAGAGAAGATGCGGGAGGCACTGAGGCG

CTTTGATGTCCTGTTTGCTGAGTTTGAACTGAG - UNI23747 - CTATGTCTCAGCCATGGTGCCAGTGAAGTCCCCCAGGGAGTACTATGTGCAGC

AGGAGGTCATCGTGCTGTTCTGTGAGACAGTGGAGAG AAATAGAAAAGCCATCCTGTTAATTCTCATGGAGTCTCCATGGATCCCATAGAGAAAACAAA

CAAACAACTTCAAAAAGAAACACGAAGAAAAAACGATCCACACAGCCTGTTTCAAAACTTACTGCAAATAAAAAATGGTGGCCCTGCCCACTTAGGAAGA

TCTGATGGCCAGCGAAATGGAACCAAGATCAGAAACCCTTCTGTCTGTGCCCAGATGATCCTGGGCCAGGATGCCCAGAGCTTCCTTTAAGGAGGAAGGG

ATGCTGTGTTCAGTGAATGCTGCTGGGACACGGCTGCCACAT
Translation
MMNRFRKWLYKPK - UNI21801 - - UNI26072 - - UNI34181 - DNVLNIINQIMEECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAE 

CLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGTLRDQALRDLNTYTEKMREALRRFDVLFAEFELS - UNI23747 - SYVSAMVPVKSPREYYVQ

QEVIVLFCETVER RNRKAILLILMESPWIP
Transcript ENSMUST00000114370
Sequence
GTAGGATGAACTAAGTGGGCATGATCCCAACAGCCTGGCTTTTGCTCTAGTTGTTTGCCTAAAATTCTTGTGGAGAAATTTGATGAGATGGCTTCTGCTT

GGGGTAGGAGAGTCCAGGTTATCCCCAGGCTTAGCCCTAGGGGTCATCACAGGGGCAGGCTGCCCTGTAGGAACAAGGCCACCAGCTATGCATCTCCTCC

AGCAGTTACCACCTCCTCATGTTCCTGGCACCTCTCTCTCCTGCAGAGGTCAGACCCACAACTGCTGGCCCAGTTCTACTATGCTGATGAGGAGCTGAAC

CAGGTGGCTGCAGAGCTGGACAGCCTGGATGGGCGGAAGGAGCCCCAGAGGTGCACACTGCTTGTCAGCCAGTTCCGCTCCTGTCAG - UNI21801 -

 - UNI26072 - - UNI34181 - GACAATGTATTAAACATCATTAATCAGATCATGGAGGAGTGTATCCCTCAGGACCGTGCCCCTCGGGATTTCT

GCGTCAAGTTTCCAGAGGAGATCCGGCATGACAACTTGGCTGGCCAGCTGTGGTTCGGGGCTGAG TGCCTGGCAGCTGGCTCCATCATCATGAATCGGG

AGCTGGAGAGCATGGCCATGCGGCCACTGGCCAAGGAGCTGACACGCAGCCTGGAGGACGTGCGGGGCACTCTCCGTGACCAGGCACTCCGAGACCTCAA

CACTTACACAGAGAAGATGCGGGAGGCACTGAGGCGCTTTGATGTCCTGTTTGCTGAGTTTGAACTGAG - UNI23747 - CTATGTCTCAGCCATGG

TGCCAGTGAAGTCCCCCAGGGAGTACTATGTGCAGCAGGAGGTCATCGTGCTGTTCTGTGAGACAGTGGAGAG AGCCTTGGATTTTGGGTATCTGACCC

AGGACATGATCGACGACTACGAACCCGCCCTCATGTTCACCATTCCTCGGCTGGCCATTGTGTG TGGCCTTGTGGTCTATGCAGATGGACCCCTGAACT

TGGACCGGAAGGTGGAGGACATGTCTGAGCTGTTCCGGCCCTTCCACACGTTGCTGCGGAAAATAAG TCCAGCCAGTGAGAAGGAGGAGGAGGAGAAGA

GGAGGAAGAAGAGGAAGAGGAGGAGGAAGAAGAAGAGGAGGAGAAAGGAGGAAGAAGAAGAGGAGGAGGAGAAAGGAGGAGGAGGAGGAAGAAAGGAAAT

GAAAGCAAGCAAGAAAAATAATGAGATGGGCATGGTGGCGCATGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTCTGAGTTTGAGGCCA

GCCCGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAATCCCTGTCTCAAAAAACAAACAAACAAAAAAAGAGGATACTATGAACAATTT

TATGTCGATCAACTTGACAATTTGAATTAAAGAAACAAATTTTACAAAACGTAATCAAAGCTGGCAGAAGAAGCAAAATTTTATAATACAGTATTAGTAA

GATAACTTAATCTATGATTTAATCCTTCCCACAAATAAAATATCAACAGACTAGATC
Translation
MASAWGRRVQVIPRLSPRGHHRGRLPCRNKATSYASPPAVTTSSCSWHLSLLQRSDPQLLAQFYYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQ

 - UNI21801 - - UNI26072 - - UNI34181 - DNVLNIINQIMEECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAE CLAAGSIIMNREL

ESMAMRPLAKELTRSLEDVRGTLRDQALRDLNTYTEKMREALRRFDVLFAEFELS - UNI23747 - SYVSAMVPVKSPREYYVQQEVIVLFCETVER

 RALDFGYLTQDMIDDYEPALMFTIPRLAIVC CGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIS SPASEKEEEEKRRKKRKRRRKKKRRRKEEEE

EEEEKGGGGGRKEMKASKKNNEMGMVAHAFNPSTREAEAGGFLSLRPARSTK
Transcript ENSMUST00000094868
Sequence
TCCTTCCGGCCGCGCACCTGCCCCGCGCACCTGCAGCCAGCTGCTCGGCGCTAGGCGCCGCGCACACGATCTGCTTGCTCAAGCAGGTCCCGGCCCTGCC

TGCGTGTCCACCCCGCGCCGCAGCCGGACCCGGGCGCAGCGCTGCAGAGGGCGAGGGCCGCCCGGAGCGTGGCTCGGGCCGGCGCGGCGATGATGAACAG

ATTCCGAAAGTGGCTGTACAAACCCAAG - UNI21801 - - UNI34181 - AGGTCAGACCCACAACTGCTGGCCCAGTTCTACTATGCTGATGAG

GAGCTGAACCAGGTGGCTGCAGAGCTGGACAGCCTGGATGGGCGGAAGGAGCCCCAGAGGTGCACACTGCTTGTCAGCCAGTTCCGCTCCTGTCAG - U

NI21801 - - UNI26072 - - UNI34181 - GACAATGTATTAAACATCATTAATCAGATCATGGAGGAGTGTATCCCTCAGGACCGTGCCCCTC

GGGATTTCTGCGTCAAGTTTCCAGAGGAGATCCGGCATGACAACTTGGCTGGCCAGCTGTGGTTCGGGGCTGAG TGCCTGGCAGCTGGCTCCATCATCA

TGAATCGGGAGCTGGAGAGCATGGCCATGCGGCCACTGGCCAAGGAGCTGACACGCAGCCTGGAGGACGTGCGGGGCACTCTCCGTGACCAGGCACTCCG

AGACCTCAACACTTACACAGAGAAGATGCGGGAGGCACTGAGGCGCTTTGATGTCCTGTTTGCTGAGTTTGAACTGAG - UNI23747 - CTATGTCT

CAGCCATGGTGCCAGTGAAGTCCCCCAGGGAGTACTATGTGCAGCAGGAGGTCATCGTGCTGTTCTGTGAGACAGTGGAGAG AGCCTTGGATTTTGGGT

ATCTGACCCAGGACATGATCGACGACTACGAACCCGCCCTCATGTTCACCATTCCTCGGCTGGCCATTGTGTG TGGCCTTGTGGTCTATGCAGATGGAC

CCCTGAACTTGGACCGGAAGGTGGAGGACATGTCTGAGCTGTTCCGGCCCTTCCACACGTTGCTGCGGAAAATAAG GGATCTGCTGCAGGCGCTGACGG

AGGAGGAGCTGCACACACTGGAGCGGAGCCTCTGTGTTTCTCAGGATGTGGAGCTCCCCATCCGGGCAGACACCCAGGCACCCAGTGCCCTGGCACCCAC

CTTTTCTGCATCTCTTCCTCCCGAGGAGACACTTTCAGCCAGTGCCAACAACCCAGAGGCAGAACTGGCCTGCTCAATGCAGTATGATGATCAGGAGTTG

GAGGAACTCAGCCGCATGGTCCACAGGGCTGGGGATGAGATGTCTTCTCTGCTTTCACCACCCAGTGCCTGCCAGTCCCCGGCACATAGGCCAGGCTCAG

AGGCTAGCCCTCGAGGGGAGGCCTCTCCAGCCAGAGCCCGGCTGAAATCAGGCAGTGATGAGGAGGAAAGGGTGTTCTTCATGGATGATGTGGAGGTGAC

AGAGTCTCCTGCCAGGCCTGAATCCCCAGGGAACACATTTGAGTTGACGCAGGGTAATGCCCAGCAGAGAGGACAAGATGGCCAGAGTGGAGAGGTGGGG

GTCGAGGCACCTGCCCTGGTAAAGGAGGAAGACTGGAGCAACAATAATGTTGAGGGTGACAAGATAAAGCTGGCCAGCCTCATGGGCTCCACTTCCTGCA

GCTGCCTAGACTCACAGCTCTACCTGGACGGCTGGGAGGTGAGTGCAGAGGATGCTGAGACTGCAGAGATGATTGCACACCGGACCGGGGGAATGAAACT

GTCAGCCACAGTCATCTTCAACCCCAAGTCTCCCACTTCCCAGGACTCAGCTGTGGCAGCCCAAGAAGCCCCAGGCCATGGTACTTCCCCTTTGGAGCCC

AGGGCAGAGGGGACAGGGGACAATTCACACAAACTCAGCACTACAGCCACCAACTGCCTCCTCCATTCCTGTGTGTGCTGTGGGAGCTGTGGGGACAGCA

GGGACGATGCTGTAGAGCGCCTGCGGGAGAAGTGTGGCCCAGGAAGTGTCATCAGTGCCTCTAACCCTTCTGTAAGCTTAGCCAAGGGTGGTGACAAAGA

GCCCGAGAGAATAGATGAGGCCCAGCCTTCTGATGTCACCCTGCCTGCAGAAGATGCCTCCAACAGGCAGGAGCCCAAAGCCCCTGCTTCCAGCAAGTGC

CTGGCACACACCTCAGGGCCTCAGGTGGACACAGCGAGCAGGTTGCAAGGAGAGGGTGAGGTCAAAGGCCAGCCAGAGCCAGAGGCCAGAAAGCAGGACC

CTGAGAAGTCCCCTGTGGTCAGCGGGGACAGTCCAAGAGGGGATGTGGCCCAGACAGAACACCAGCACCTGTTGGGCTCCAG CTCCACGGTTGGTTCCT

GCTCCTTAGACAACACCAGGTTGGATGTGGCCACTGCTGCCATGCCTGTCACCCCCATGGCCACCAGAGAGAAGATCCGGTCCAGGTTCCATGGCAGCCA

TGACCTGATCCACCGCCTGTTTGTCTGCATTTCAG GTGTAGCAGACCAGCTACAGACGAACTATGCTAGCGACCTGAGAAGTATTCTCAAAACACTGTT

TGAGGTCATGGCCACCAAGCCAGAAACAGATGACAAAGAGAAGCTAAAGAAGG TAACTCAGACCCTGCGGAGTGCAGCCTTGGAGGACTGTGCACTGTG

CCAGGAGACTGTGTCATCCTCAGAACTGGCAGCCAAGACCCGAGATGGGGACTTTGAAG ACCCTCCTGAGTGGGTGCCAGATGAGGCCTGTGGCTTCTG

CACCTCCTGTAAAGCTCCCTTCACCGTCATCCGCAGGAAGCACCACTGTCGCAGCTGTGGTAAG ATCTTCTGTTCCCGCTGCTCATCCCACTCGGCGCC

GCTTCCGCGCTACGGACAGGTGAAGCCCGTCCGTGTGTGTACACACTGCTACATGTTCCACGTCACACCCTTCTACAGTGACAAGACGGGCATGTGATGC

TGTGCCTGGCATGTCCCAGCTGAGCAGGCTGTCTAGAGTCCTATCCAGGGTCTCCGGGAAGGAGGTGCTGTGCCTGCTGTGTGCCCTGTCCAGGCTGTGC

TGCAGGAGGGCCTCATTTCATCTCATCATGCCACAGCTGCTGCAGGCCTGACCAGGTTCCAGAAGGCCCAGAGTCTCTGTCTACTACTCTCCTTTGCCTC

TCCACTGTGGAGACACCAGTCCTGGCATGGGCCAATGAGAGGTCAGCTTTATTCAGAGGAGGGACCCAGGGATGCCCAGTTGCTGCTTCCAGGTCTAGTT

ACTTGGTTAGGCAGGGTTGAACTTTCTTCTCTTGCCCATCTACAGCATTTTGCTCCAGCTGTGCATAGCAAGGCAGGAGAGGGCCAATTCTGTGTGTTCT

CTTCTGTAGCCAAGAATCTGGAAACAGAAGCCAGGGGGTGTTGGGCCTCAACATCATAGCAGAACTCCCTGCCTGTTCACCACACTCCTCATCCCCTAGA

TGAGGAACCTCCCCGCCTCAGAACCTCCTCAACAACATACATCTCATTTCCTTTTGAAGGGGGGAATGTAGGAAGCAGACATAGTGGTCTCCAGGGGAAG

TAAGCATGCTCTTGGCATCTACGCCATTGCCACTTGCTGGTGGAGCAGGGGCTGACCACTCACTGATATTGTAGGCTGAGCTCTCAGGTGTTTGGCCTGG

ACCCATCAGGCAGCTTAGCTACTATTCCCTTCTTCCACTGCACCCGCTGGGACTCTAACCCACTTCCTCAGACCTCAGTGCGGCCTAGACAGGCTGAGAT

GCACAGACACCTCCTCAGGCTTCAATCTCAGGCTTCACGTTGCAATGATGATTACAGTTTTATTTTTAGAGAGATGACACACCTACTGCTTCTTTTATAG

GATAAAATCCAACCGCTGCTCAGCAGTGGAAGACACAAAATGCACAAAAATGGCTTCTGTGTGGGGGAGGTGGGGAGAGTGTATAACAGAGGGAATATTA

TGTATTGAGATGATTTTTATTTTCTAAATGCTGTAATTCAAAACCATTTCCATAAATCTATTTAAGGATTGCACACGCTCTGGCGTCTTCTA
Translation
MMNRFRKWLYKPK - UNI21801 - - UNI34181 - RSDPQLLAQFYYADEELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQ - UNI21801 -

 - UNI26072 - - UNI34181 - DNVLNIINQIMEECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAE CLAAGSIIMNRELESMAMRPLAKELT

RSLEDVRGTLRDQALRDLNTYTEKMREALRRFDVLFAEFELS - UNI23747 - SYVSAMVPVKSPREYYVQQEVIVLFCETVER RALDFGYLTQDM

IDDYEPALMFTIPRLAIVC CGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIR RDLLQALTEEELHTLERSLCVSQDVELPIRADTQAPSALAPTFS

ASLPPEETLSASANNPEAELACSMQYDDQELEELSRMVHRAGDEMSSLLSPPSACQSPAHRPGSEASPRGEASPARARLKSGSDEEERVFFMDDVEVTES

PARPESPGNTFELTQGNAQQRGQDGQSGEVGVEAPALVKEEDWSNNNVEGDKIKLASLMGSTSCSCLDSQLYLDGWEVSAEDAETAEMIAHRTGGMKLSA

TVIFNPKSPTSQDSAVAAQEAPGHGTSPLEPRAEGTGDNSHKLSTTATNCLLHSCVCCGSCGDSRDDAVERLREKCGPGSVISASNPSVSLAKGGDKEPE

RIDEAQPSDVTLPAEDASNRQEPKAPASSKCLAHTSGPQVDTASRLQGEGEVKGQPEPEARKQDPEKSPVVSGDSPRGDVAQTEHQHLLGSS SSTVGSC

SLDNTRLDVATAAMPVTPMATREKIRSRFHGSHDLIHRLFVCISG GVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKLKKV VTQTLRSAALEDC

ALCQETVSSSELAAKTRDGDFED DPPEWVPDEACGFCTSCKAPFTVIRRKHHCRSCGK IFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDK

TGM
Transcript ENSMUST00000042566
Sequence
TCCTTCCGGCCGCGCACCTGCCCCGCGCACCTGCAGCCAGCTGCTCGGCGCTAGGCGCCGCGCACACGATCTGCTTGCTCAAGCAGGTCCCGGCCCTGCC

TGCGTGTCCACCCCGCGCCGCAGCCGGACCCGGGCGCAGCGCTGCAGAGGGCGAGGGCCGCCCGGAGCGTGGCTCGGGCCGGCGCGGCGATGATGAACAG

ATTCCGAAAGTGGCTGTACAAACCCAAG - UNI21801 - - UNI34181 - AGGTCAGACCCACAACTGCTGGCCCAGTTCTACTATGCTGATGAG

GAGCTGAACCAGGTGGCTGCAGAGCTGGACAGCCTGGATGGGCGGAAGGAGCCCCAGAGGTGCACACTGCTTGTCAGCCAGTTCCGCTCCTGTCAG - U

NI21801 - - UNI26072 - - UNI34181 - GACAATGTATTAAACATCATTAATCAGATCATGGAGGAGTGTATCCCTCAGGACCGTGCCCCTC

GGGATTTCTGCGTCAAGTTTCCAGAGGAGATCCGGCATGACAACTTGGCTGGCCAGCTGTGGTTCGGGGCTGAG TGCCTGGCAGCTGGCTCCATCATCA

TGAATCGGGAGCTGGAGAGCATGGCCATGCGGCCACTGGCCAAGGAGCTGACACGCAGCCTGGAGGACGTGCGGGGCACTCTCCGTGACCAGGCACTCCG

AGACCTCAACACTTACACAGAGAAGATGCGGGAGGCACTGAGGCGCTTTGATGTCCTGTTTGCTGAGTTTGAACTGAG - UNI23747 - CTATGTCT

CAGCCATGGTGCCAGTGAAGTCCCCCAGGGAGTACTATGTGCAGCAGGAGGTCATCGTGCTGTTCTGTGAGACAGTGGAGAG AGCCTTGGATTTTGGGT

ATCTGACCCAGGACATGATCGACGACTACGAACCCGCCCTCATGTTCACCATTCCTCGGCTGGCCATTGTGTG TGGCCTTGTGGTCTATGCAGATGGAC

CCCTGAACTTGGACCGGAAGGTGGAGGACATGTCTGAGCTGTTCCGGCCCTTCCACACGTTGCTGCGGAAAATAAG GGATCTGCTGCAGGCGCTGACGG

AGGAGGAGCTGCACACACTGGAGCGGAGCCTCTGTGTTTCTCAGGATGTGGAGCTCCCCATCCGGGCAGACACCCAGGCACCCAGTGCCCTGGCACCCAC

CTTTTCTGCATCTCTTCCTCCCGAGGAGACACTTTCAGCCAGTGCCAACAACCCAGAGGCAGAACTGGCCTGCTCAATGCAGTATGATGATCAGGAGTTG

GAGGAACTCAGCCGCATGGTCCACAGGGCTGGGGATGAGATGTCTTCTCTGCTTTCACCACCCAGTGCCTGCCAGTCCCCGGCACATAGGCCAGGCTCAG

AGGCTAGCCCTCGAGGGGAGGCCTCTCCAGCCAGAGCCCGGCTGAAATCAGGCAGTGATGAGGAGGAAAGGGTGTTCTTCATGGATGATGTGGAGGTGAC

AGAGTCTCCTGCCAGGCCTGAATCCCCAGGGAACACATTTGAGTTGACGCAGGGTAATGCCCAGCAGAGAGGACAAGATGGCCAGAGTGGAGAGGTGGGG

GTCGAGGCACCTGCCCTGGTAAAGGAGGAAGACTGGAGCAACAATAATGTTGAGGGTGACAAGATAAAGCTGGCCAGCCTCATGGGCTCCACTTCCTGCA

GCTGCCTAGACTCACAGCTCTACCTGGACGGCTGGGAGGTGAGTGCAGAGGATGCTGAGACTGCAGAGATGATTGCACACCGGACCGGGGGAATGAAACT

GTCAGCCACAGTCATCTTCAACCCCAAGTCTCCCACTTCCCAGGACTCAGCTGTGGCAGCCCAAGAAGCCCCAGGCCATGGTACTTCCCCTTTGGAGCCC

AGGGCAGAGGGGACAGGGGACAATTCACACAAACTCAGCACTACAGCCACCAACTGCCTCCTCCATTCCTGTGTGTGCTGTGGGAGCTGTGGGGACAGCA

GGGACGATGCTGTAGAGCGCCTGCGGGAGAAGTGTGGCCCAGGAAGTGTCATCAGTGCCTCTAACCCTTCTGTAAGCTTAGCCAAGGGTGGTGACAAAGA

GCCCGAGAGAATAGATGAGGCCCAGCCTTCTGATGTCACCCTGCCTGCAGAAGATGCCTCCAACAGGCAGGAGCCCAAAGCCCCTGCTTCCAGCAAGTGC

CTGGCACACACCTCAGGGCCTCAGGTGGACACAGCGAGCAGGTTGCAAGGAGAGGGTGAGGTCAAAGGCCAGCCAGAGCCAGAGGCCAGAAAGCAGGACC

CTGAGAAGTCCCCTGTGGTCAGCGGGGACAGTCCAAGAGGGGATGTGGCCCAGACAGAACACCAGCACCTGTTGGGCTCCAG CTCCACGGTTGGTTCCT

GCTCCTTAGACAACACCAGGTTGGATGTGGCCACTGCTGCCATGCCTGTCACCCCCATGGCCACCAGAGAGAAGATCCGGTCCAGGTTCCATGGCAGCCA

TGACCTGATCCACCGCCTGTTTGTCTGCATTTCAG GTGTAGCAGACCAGCTACAGACGAACTATGCTAGCGACCTGAGAAGTATTCTCAAAACACTGTT

TGAGGTCATGGCCACCAAGCCAGAAACAGATGACAAAGAGAAGCTAAAGAAGG TAACTCAGACCCTGCGGAGTGCAGCCTTGGAGGACTGTGCACTGTG

CCAGGAGACTGTGTCATCCTCAGAACTGGCAGCCAAGACCCGAGATGGGGACTTTGAAG ACCCTCCTGAGTGGGTGCCAGATGAGGCCTGTGGCTTCTG

CACCTCCTGTAAAGCTCCCTTCACCGTCATCCGCAGGAAGCACCACTGTCGCAGCTGTGGTAAG ATCTTCTGTTCCCGCTGCTCATCCCACTCGGCGCC

GCTTCCGCGCTACGGACAGGTGAAGCCCGTCCGTGTGTGTACACACTGCTACATGTTCCACGTCACACCCTTCTACAGTGACAAGACGGGCATGTGATGC

TGTGCCTGGCATGTCCCAGCTGAGCAGGCTGTCTAGAGTCCTATCCAGGGTCTCCGGGAAGGAGGTGCTGTGCCTGCTGTGTGCCCTGTCCAGGCTGTGC

TGCAGGAGGGCCTCATTTCATCTCATCATGCCACAGCTGCTGCAGGCCTGACCAGGTTCCAGAAGGCCCAGAGTCTCTGTCTACTACTCTCCTTTGCCTC

TCCACTGTGGAGACACCAGTCCTGGCATGGGCCAATGAGAGGTCAGCTTTATTCAGAGGAGGGACCCAGGGATGCCCAGTTGCTGCTTCCAGGTCTAGTT

ACTTGGTTAGGCAGGGTTGAACTTTCTTCTCTTGCCCATCTACAGCATTTTGCTCCAGCTGTGCATAGCAAGGCAGGAGAGGGCCAATTCTGTGTGTTCT

CTTCTGTAGCCAAGAATCTGGAAACAGAAGCCAGGGGGTGTTGGGCCTCAACATCATAGCAGAACTCCCTGCCTGTTCACCACACTCCTCATCCCCTAGA

TGAGGAACCTCCCCGCCTCAGAACCTCCTCAACAACATACATCTCATTTCCTTTTGAAGGGGGGAATGTAGGAAGCAGACATAGTGGTCTCCAGGGGAAG

TAAGCATGCTCTTGGCATCTACGCCATTGCCACTTGCTGGTGGAGCAGGGGCTGACCACTCACTGATATTGTAGGCTGAGCTCTCAGGTGTTTGGCCTGG

ACCCATCAGGCAGCTTAGCTACTATTCCCTTCTTCCACTGCACCCGCTGGGACTCTAACCCACTTCCTCAGACCTCAGTGCGGCCTAGACAGGCTGAGAT

GCACAGACACCTCCTCAGGCTTCAATCTCAGGCTTCACGTTGCAATGATGATTACAGTTTTATTTTTAGAGAGATGACACACCTACTGCTTCTTTTATAG

GATAAAATCCAACCGCTGCTCAGCAGTGGAAGACACAAAATGCACAAAAATGGCTTCTGTGTGGGGGAGGTGGGGAGAGTGTATAACAGAGGGAATATTA

TGTATTGAGATGATTTTTATTTTCTAAATGCTGTAATTCAAAACCATTTCCATAAATCTATTTAAGGATTGCACACGCTCTGGCGTCTTCTATG
Translation
APRTRSACSSRSRPCLRVHPAPQPDPGAALQRARAARSVARAGAAMMNRFRKWLYKPK - UNI21801 - - UNI34181 - RSDPQLLAQFYYADE

ELNQVAAELDSLDGRKEPQRCTLLVSQFRSCQ - UNI21801 - - UNI26072 - - UNI34181 - DNVLNIINQIMEECIPQDRAPRDFCVKF

PEEIRHDNLAGQLWFGAE CLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGTLRDQALRDLNTYTEKMREALRRFDVLFAEFELS - UNI23747 -

 SYVSAMVPVKSPREYYVQQEVIVLFCETVER RALDFGYLTQDMIDDYEPALMFTIPRLAIVC CGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIR

 RDLLQALTEEELHTLERSLCVSQDVELPIRADTQAPSALAPTFSASLPPEETLSASANNPEAELACSMQYDDQELEELSRMVHRAGDEMSSLLSPPSAC

QSPAHRPGSEASPRGEASPARARLKSGSDEEERVFFMDDVEVTESPARPESPGNTFELTQGNAQQRGQDGQSGEVGVEAPALVKEEDWSNNNVEGDKIKL

ASLMGSTSCSCLDSQLYLDGWEVSAEDAETAEMIAHRTGGMKLSATVIFNPKSPTSQDSAVAAQEAPGHGTSPLEPRAEGTGDNSHKLSTTATNCLLHSC

VCCGSCGDSRDDAVERLREKCGPGSVISASNPSVSLAKGGDKEPERIDEAQPSDVTLPAEDASNRQEPKAPASSKCLAHTSGPQVDTASRLQGEGEVKGQ

PEPEARKQDPEKSPVVSGDSPRGDVAQTEHQHLLGSS SSTVGSCSLDNTRLDVATAAMPVTPMATREKIRSRFHGSHDLIHRLFVCISG GVADQLQTN

YASDLRSILKTLFEVMATKPETDDKEKLKKV VTQTLRSAALEDCALCQETVSSSELAAKTRDGDFED DPPEWVPDEACGFCTSCKAPFTVIRRKHHCR

SCGK IFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKTGM

For any suggestions or comments, please send an email to unitrap@crg.es