Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037234 (Hook3)
Chromosomal location
Chr 8: 27139381 - 27229642 (-)
Description
hook homolog 3 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:2443554]
RefSeq_dna
NM_207659 
RefSeq_peptide
NP_997542.1 
UniGene
Mm.334464 Mm.412998 
MGI
MGI:2443554 
Uniprot/SWISSPROT
Q8BUK6 
Uniprot/SPTREMBL
Q3UUZ6 Q540A0 Q5BKS5 
Human Ortholog
ENSG00000168172 (HOOK3)
Omim not available
UniTrap UNI22828
Vector Insertion
Chr 8: 27221294 - 27229429
Public Clones not available
Private Clones OST283710 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26934
Vector Insertion
Chr 8: 27206303 - 27221207
Public Clones IST10196G11 (tigm)
Private Clones OST84603 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35863
Vector Insertion
Chr 8: 27198531 - 27204180
Public Clones IST14843C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32742
Vector Insertion
Chr 8: 27185339 - 27193054
Public Clones IST12128F10 (tigm) IST10898D7 (tigm) IST12514H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36229
Vector Insertion
Chr 8: 27184071 - 27185403
Public Clones IST14804H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22032
Vector Insertion
Chr 8: 27182893 - 27184071
Public Clones not available
Private Clones OST311073 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35361
Vector Insertion
Chr 8: 27179030 - 27180748
Public Clones IST12644F3 (tigm) IST12639E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18577
Vector Insertion
Chr 8: 27171919 - 27178321
Public Clones (sanger) CMHD-GT_516A12-5S (cmhd) IST10316C5 (tigm) IST12368C11 (tigm)
IST13513F3 (tigm) IST11081C3 (tigm) IST11928H11 (tigm) IST10851E12 (tigm)
IST12003H4 (tigm) IST14728B6 (tigm) IST14156A8 (tigm) IST13749E2 (tigm)
IST14431D1 (tigm) IST12270B10 (tigm) IST10987H12 (tigm) IST14303B6 (tigm)
IST10385C7 (tigm) IST10420E1 (tigm) IST10235F9 (tigm) IST10219A12 (tigm)
IST12009F9 (tigm) IST11573A9 (tigm) IST10931H12 (tigm) IST11780C12 (tigm)
IST10357E4 (tigm) IST15108A5 (tigm) IST12046B5 (tigm) IST10537C9 (tigm)
IST11619A11 (tigm) IST11322C1 (tigm) IST11722E2 (tigm) IST10584H11 (tigm)
IST11292C9 (tigm) IST10843B1 (tigm) IST13920C2 (tigm) IST10851H12 (tigm)
IST11697C12 (tigm) IST12062C7 (tigm) IST12293G2 (tigm)
Private Clones OST420376 (lexicon) OST391839 (lexicon) OST285181 (lexicon) OST252893 (lexicon)
OST188161 (lexicon) OST174534 (lexicon) OST65663 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16012
Vector Insertion
Chr 8: 27169853 - 27171848
Public Clones (sanger) D093F07 (ggtc) E005D02 (ggtc) IST13066G6 (tigm) IST14806G5 (tigm)
Private Clones OST468067 (lexicon) OST433194 (lexicon) OST243644 (lexicon) OST200040 (lexicon)
OST172909 (lexicon) OST151477 (lexicon) OST55541 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4726
Vector Insertion
Chr 8: 27158812 - 27169711
Public Clones XR0148 (sanger) XR0192 (sanger)
Private Clones OST198038 (lexicon) OST182427 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24275
Vector Insertion
Chr 8: 27154747 - 27158723
Public Clones not available
Private Clones OST226129 (lexicon) OST206716 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25362
Vector Insertion
Chr 8: 27145710 - 27148493
Public Clones not available
Private Clones OST186678 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037182
Sequence
GCGATTGCCAGCGTCCGCGCCCCGGGAGCGGACGGACGGAAGAGAAGGTCCGCCAGACGCCCGGTCTGCTGCCTGACCCCTTCGGACTCAAACCCCGAGC

CGAGCGGCCGCGGCTTCTGGTTGGTTGAAGGGAGACGCTGCGGCCACCCCAGGAAGATGTTTAACGTGGAGTCTGTGGAGCGGGTGGAGCTGTGCGAGAG

CCTGCTCACTTGG - UNI22828 - ATCCAGACCTTTAATGTGGATGCACCGTGCCAGACCGCGGAGGACTTAACGAACGGCGTTGTCATGTCCCAGG

TTCTTCAGAAGAT - UNI26934 - AGATCCTGTATATTTCGACGATAATTGGCTAAACAGAATCAAAACTGAAGTAGGAGACAATTGGAGGTTAAAG

 - UNI35863 - ATCAGCAATTTAAAGAAAATTTTAAAAGGCATCTTGGATTACAATCATGAG - UNI35863 - ATTTTAGGACAGCAGATTAAT

GATTTCACCCTTCCTGACGTGAACCTCATTGGGGAGCATTCGGATGCAGCAGAGCTCGGAAGGATGCTGCAGCTCATTCTAGGCTGTGCTGTGAACTGTG

AGCAGAAGCAAG - UNI32742 - - UNI35863 - AGTACATTCAAGCCATTATGATGATGGAGGAATCTGTTCAGCATGTCGTCATGACAGCCAT

TCAAGAG - UNI32742 - - UNI36229 - CTAATGAGTAAAGAGTCTCCTGTCTCTGCTGGACATGATGCCTATGTTGATCTTGATCGCCAG - 

UNI32742 - - UNI36229 - TTGAAGAAAACTACCGAAGAACTAAATGAAGCTTTGTCAGCAAAGGAGGAAATTGCTCAAAGATGCCATGAATTGG

ATATGCAG - UNI22032 - - UNI36229 - GTTGCAGCACTGCAAGAGGAGAAAAGTAGTTTATTGGCAGAAAATCAGATACTAATGGAACGACT

CAATCAATCTGATTCTATAGAAGATCCCAATAGCCCAGCAGGAAGAAGACATTTGCAACTTCAGACTCAGTTAGAACAGCTGCAAGAAGAAACATTCAG 

ACTAGAAGCAGCCAAAGACGATTATCGAATCCGCTGTGAGGAGTTAGAAAAGGAAATCTCTGAGCTTCGGCAGCAGAACGATGAGCTGACCACTTTGGCA

GACGAAGCTCAGTCTCTAAAGGATGAAATAGACGTTCTCAG - UNI35361 - ACACTCTTCTGATAAAGTATCTAAACTAGAAGGCCAAGTCGAATC

TTATAAGAAGAAGCTGGAAGACCTTGGAGATTTGAGGCGGCAGGTTAAGCTCTTGGAAGAAAAGAATACGATGTACATGCAGAACACTGTCAGTCTGGAG

GAAGAGTTAAGAAAAGCTAATGCCGCCCGGGGACAGCTTGAGACATACAAGAGACAA - UNI35361 - GTTGTAGAGCTGCAAAATAGATTATCTGA

CGAATCAAAGAAAGCAGATAAGTTAGATTTTGAATATAAGCGGCTAAAAGAAAAAGTTGATGGTCTTCAGAAAGAAAAAGAT - UNI35361 - AGGT

TAAGAACGGAAAGAGATTCTCTGAAGGAAACCATTGAAGAGTTGCGTTGTGTGCAGGCTCAGGAGGGGCAGCTCACCACTCAAG - UNI18577 - GG

TTAATGCCTCTGGGAAGCCAGGAATCTTCAGACAGCCTTGCAGCAGAGATTGTTACACCCGAAATCAG - UNI16012 - GGAGAAACTTATTCGTCT

TCAGCATGAGAATAAAATGTTAAAACTCAATCAAGAGGATTCAGACAATGAGAAAATTGCCTTATTGCAGAGCCTTCTAGATGATGCAAATCTACGCAAG

AATGAGCTGGAGACGGAGAACAG - UNI4726 - GCTTGTGAATCAGAGACTTCTAGAAGTACAGTCACAAGTAGAAGAACTGCAAAAATCTTTGCAG

GATCAAGGTTCAAAAGCAGAAGAT - UNI24275 - TCAGTTCTTCTAAAAAAGAAGCTTGAAGAACATCT AGAGAAGCTGCATGAAGCCAACAATG

AATTGCAGAAAAAGAGAGCCATTATTGAAGATCTCGAGCCAAGATTTAACAACAGCT CCTTAAGAATTGAAGAATTGCAAGAGGCTTTACGGAAGAAAG

AAGAAGAAATGAAGCAAATGGAAGAACGCTATAAAAAATACTTAGAGAAGGCCAAGAGT - UNI25362 - GTTATCCGTACATTAGACCCTAAACAG

AATCAAGGAGCAGCACCAGAAATTCAAGCTCTTAAAAATCAACTGCAGGAACGGGACCGACTCTTCCACTCATTAGAG AAAGAATATGAGAAAACGAAG

AGTCAAAGAGACATGGAGGAGAAATACATTGTTAGTGCCTGGTACAATATG GGAATGACTCTACATAAAAAGGCGGCTGAAGACAGACTAGCTAGCACA

GGTTCAGGGCAGTCATTTCTGGCTAGGCAAAGACAAGCAACCAGCACAAGAAGATCCTACCCAGGCCATGTCCAGCCAGCCACAGCAAGGTAGAAAGGTC

TTGCCACTAGGAATTTTTAAAAAGCATACTTCTGTTACATATAACAACATTTCAGGAAATTCAGCCAGCTTGTTTTCTTTCTCTCCTGTGTTAATATTTA

GTGTTTCTCATGAGGATTCCTCTCTCTCCTATCTTTGGTTACTTTGTCCTTTACTTTGTGGTCTTTTCAGTTCCTTTTAATGTGCCAAAAATTTGTAAAT

GTACAATTAAAAGTGTTGTATAATAGTGTAATACTTTTTCTTTGTATGAAAATGTCTTCTTCCCCATTTGTGTGGGCTTTGTAAAGAATCGGGTTTTCTG

CCAATAATTGATACACAATTTATATTCTTTATCGTGCCTACTGTGTTACCATACTTTATAAGAATGTCTTTGTTTAAAGGGAATTAATCTTTTTATGGTG

TATTAATCTGTGTTTTCGATTGTTTTCCAAATGCACTTCAGATAACTTAAATATTTACTGTACTATACAAAGTGGTGTCAAATGCACTTTTTGCAAAGAC

GACTACATTGGCAGAGGTGCTAGTCAGACCTGTGGCACCTGGCAGGATCACTCAGAGGGGAGAAATTAAACGTATTCTAAGGTTTGAAGTTCTTATATGA

AATTTCATTCTTTCCTGCTGTATTGTTTGCTGGCAGAAGTGAAATTGGTGAAGATATTTGGGTGGAAATTACAGAGAAGAAGAACTTGGCAGGATTTTTT

TTCCTTCCTTTGGAATATCTTAGTAGCTAAGAACCAGATTCTAGCCATGCACTTTTAATTGCTCTCCACATGTAAAAGATTTATTTTCATATAGGTAGCC

TTATCTTTGGGGCAGTTCTTTGACTATGCCTCATATGTTTTATATATTCTGTGAGACTTTCCTTTTCTTAGTTAGCCTTGATAGCTAGCATCTTAATGCG

ATTTGTTAACATCAGCACATGGCTCGGTGTGTAATGTTATAACAGAGCTCTATAGTTTCTCTTCGCTCTACCTACAGCTCCAAGAATTGGTAACAGGAGA

GATTTTCTTGGTATTTGGTTGTTCAAAGTGCTTACATTATATGCCACATTTATTTACATAGATGAATGTCTATTAAGCAATCATGTGAAGTACTTTGTCT

ATATAAGGAATGATATAATTTTAAACTATCATTTATTTGAAAATAATCTACCTTTGTCTTTTTCTATATTGATTTGTGAATTTGATCCCAAATTATATTG

AAGGTTTCCTCCAGCCTTTTTCTTGTTTCATACCATATTTTTTGAAAGAAAAAATATGAAATTAAGTCAGAGGGTTCTTTAGTTTGTTTTTACATAAATC

ATCTTAAGTGGAAGATGTTATTTATGGACTTGGTGTTTGGAAGTTCTGGTGTCATTTAGTTCTGTATAAAAGACAAATAACTAACTCAACTTTACTGTGA

TGAAGAATTTTCAGAAACCATATTCAAGTGCTTCATTTTAACTCCCTCCTGTTTTATAGGAAAATTGACCTAGAAATTCGTCCTGCATGTTTTGTCTTGG

TTTTGTAGACGGAGTCTTTATGTAACCCAGGCTGCCATGAACACATGGTCTTCTTGGATTATACGCATGAATCGTAGGATTTTTTTTTCCTTGAAAGGAC

ACTATTCATCATGAAGCATTTATTTAAAAACAAACAAACAAACAAAAAAACCTCACAAAAACAAAAACAACCCTTCCAACAAATGTTCAAGCAGGCTGTG

AGGCATCCGCCTGGGCAGACCAAAGCAGCAGGCACAGGAAATAGTGGAGAGCACTACAGTGGGACAGAGAGCAGCAGGCACAGGAGATAGTGGAGAGCGC

TATGGTGGGACAGTGCTCTGTGGGATTTCAGGTACACACACCTGACACTCGAGGTCTGCTTTTTTTGTTGTTATTGTTTTAAGACAATCTAGGGATATTA

TCCAGACCTTCCTCAACTTCTTTGACTCAAGACTATTCTCCTGCCTCTGCCTCCCAAGAGGCTGAGATTAAGGTATGTGCCACCATGTCCACAGGGTAGA

TTGAGTTTGAAAATAAAAGAACAAAAACTGGGGCCAGCACAATGGCTCAGCAGGAAGCGTAGCACTTGCCTGGGCTCACTTCCTGGGGCCTAGGTGACAG

GGGACAGCAACTCCCAAGGGTTGTCCTCTGGTCTCCACACTCAACAGATGCCAGTGCACACACAAATAAGTATGCTTGAAAGGTTTTAAATAGTTCTCAC

TCTACCTTTAGCTCACAGAATATCTGAGATTCAACCACTTGTAAATCAAATTAGTCTATGGTTCCTACTCCTTACAAGATTGTTGGTTGTTGAGAAATTA

TACCTGGAGAATAAAGTGAATGTGAATACAAGAGACGCTTGAAGCTACCCTTCAGTAGATCTTACCCTGAGGGAAAACAGCTCACTGTTTTGATTTTTAT

TTTCTATTCACCTGCCCGCTCTATAGACATACCCACCTACCCAGATATTTTATGTAGATGTTTTGGAAAGGCCTCAAGCTTTCAGAAGGAAGTTTAGCTT

CTGCTTTTTGTTTTGTTTTGTTTTCAGCATCTGTTTTGTGCTAATTTCAGTGTCTGTAGCCTCTGCTGTTGTTTGCTCTGTCTTTAATGTTTGGTGGATT

TCCTTCAGTAAATGGGAGAAATATCGCTCATGATATTTCAGAATAAAATAAAACATGCTTTCATAAGAAATAGCATCCGTCTATACTTTAGACGTCATAA

AGCCAGGAATACAACTTACCTGTGCCAGTGGCACCTTTCCCACTGTGTGGCTTAGGTCAGGATTTAGGGGACTTCAGTTTCTCCCGTGGAGATCAGGGAA

GTTGCAGGTGCTCTGGTGGTGTGTGGTAAGCCTCCTGTGCTTGCCCCATGGATCTTGTCCTGGCATTAGCAAGGGATGAGGACACTGTCACTGTGTCAGG

TAGGGAGGACCTGTCACCAGCATCTGAGTTCTTATAATAAGCTTATTTTCTGTGCCTTCTAACCAGGGTTTACC
Translation
MFNVESVERVELCESLLTW - UNI22828 - IQTFNVDAPCQTAEDLTNGVVMSQVLQKI - UNI26934 - IDPVYFDDNWLNRIKTEVGDNWRL

K - UNI35863 - ISNLKKILKGILDYNHE - UNI35863 - ILGQQINDFTLPDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQE - UNI327

42 - - UNI35863 - EYIQAIMMMEESVQHVVMTAIQE - UNI32742 - - UNI36229 - LMSKESPVSAGHDAYVDLDRQ - UNI32742

 - - UNI36229 - LKKTTEELNEALSAKEEIAQRCHELDMQ - UNI22032 - - UNI36229 - VAALQEEKSSLLAENQILMERLNQSDSIE

DPNSPAGRRHLQLQTQLEQLQEETFR RLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLKDEIDVLR - UNI35361 - RHSSDKVSKLE

GQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRKANAARGQLETYKRQ - UNI35361 - VVELQNRLSDESKKADKLDFEYKRLKEKV

DGLQKEKD - UNI35361 - RLRTERDSLKETIEELRCVQAQEGQLTTQG - UNI18577 - GLMPLGSQESSDSLAAEIVTPEIR - UNI1601

2 - REKLIRLQHENKMLKLNQEDSDNEKIALLQSLLDDANLRKNELETENR - UNI4726 - RLVNQRLLEVQSQVEELQKSLQDQGSKAED - UN

I24275 - SVLLKKKLEEHL LEKLHEANNELQKKRAIIEDLEPRFNNSS SLRIEELQEALRKKEEEMKQMEERYKKYLEKAKS - UNI25362 - 

VIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLE KEYEKTKSQRDMEEKYIVSAWYNM GMTLHKKAAEDRLASTGSGQSFLARQRQATSTRRSYPGH

VQPATAR

For any suggestions or comments, please send an email to unitrap@crg.es