Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037287 (Tbcel)
Chromosomal location
Chr 9: 42220400 - 42280309 (-)
Description
tubulin folding cofactor E-like Gene [Source:MGI Symbol;Acc:MGI:1925543]
RefSeq_dna
NM_173038 
RefSeq_peptide
NP_766626.1 
UniGene
Mm.34483 Mm.468742 
MGI
MGI:1925543 
Uniprot/SWISSPROT
Q8C5W3 
Human Ortholog
ENSG00000154114 (TBCEL)
Omim not available
UniTrap UNI29651
Vector Insertion
Chr 9: 42269356 - 42280310
Public Clones (sanger) D163G03 (ggtc) D163H05 (ggtc) D105B03 (ggtc) E126E03 (ggtc)
D081G04 (ggtc) IST15024B12 (tigm) IST14315C6 (tigm) IST14642D8 (tigm)
IST14154G11 (tigm) IST11320C10 (tigm) IST14953B7 (tigm) IST14953B6 (tigm)
IST10544F3 (tigm) IST14605A9 (tigm) IST10458C2 (tigm) IST10551B11 (tigm)
IST14155D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22778
Vector Insertion
Chr 9: 42259846 - 42269356
Public Clones (sanger) E032G07 (ggtc) E046A09 (ggtc) E026A05 (ggtc) E126C05 (ggtc)
E047A01 (ggtc) IST10461D6 (tigm) IST11198C7 (tigm) IST10329B9 (tigm)
IST14389E11 (tigm) IST13379D7 (tigm)
Private Clones OST285113 (lexicon) OST215886 (lexicon) OST179156 (lexicon) OST134235 (lexicon)
OST130796 (lexicon) OST123919 (lexicon) OST57217 (lexicon) OST32358 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14671
Vector Insertion
Chr 9: 42259695 - 42269486
Public Clones FHCRC-GT-S2-11A1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21525
Vector Insertion
Chr 9: 42258147 - 42259695
Public Clones not available
Private Clones OST327187 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18052
Vector Insertion
Chr 9: 42247307 - 42250901
Public Clones not available
Private Clones OST431284 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19632
Vector Insertion
Chr 9: 42224233 - 42245197
Public Clones not available
Private Clones OST385841 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066148
Sequence
GGGTCAATGCAGGACACTGGGCTCTGGCGGCCGGAGAAGGGGTCGAGGTGAAGTGGAGCCGGTCCGGGGCCGGCCTGGAGCAGGCCGGAAGCCGAGCGGC

GACGCGGTGGCCGGGCGGGCGGAGGCGCAGCCCGAGGAGCCGCCGCCTCCCGGGCCGAGGG - UNI14671 - - UNI22778 - - UNI29651 -

 ACTTTTCAGAAAAGAAGATGGACCAGCCTAGTGGGAGAAGTTTCATGCAAGTATTGTGTGAAAAATACAGTCCTGAAAACTTCCCTTACCGCCGTGGCC

CTGGGGTGGGAGTCCATGTCCCAGCCACTCCCCAGGGCTCGCCTATGAAAG - UNI14671 - - UNI21525 - ATCGCCTCAACCTCCCGAGCGT

GCTCGTGTTGAACAGCTGCGGCATTACCTGCGCGGGAGATGAAAGAGAAATCGCAGCCTTCTGTGCTCACGTGTCAGAACTCGATCTTTCTGACAACAAG

CTCCAAGACTGGCATGAG GTCAGTAAGATTGTGTCAAATGTTCCTCAGCTGGAGTTTCTAAACCTGAGTTCCAATCCTCTGAGTCTGTCAGTTCTAGAA

AGAACATGTGCTGGGTCCTTCTCTGGGGTTCGCAAACTTGTCCTCAACAACAGCAAAGCATCATGGGAAACAGTGCACACCATACTGCAGGAGTTGCCAG

A GTTGGAGGAGCTCTTCCTGTGCCTTAATGACTATGAAACAGTGTCTTGTCCTTCTGTCTGCTGTCATTCCCTCAAGCTCCTACACATCACAGACAACA

ACCTCCAAGACTGGACTGAAATCCGAAAGCTGGGTGTAATGTTTCCTTCACTGGATACCCTGGTCCTGGCCAACAATCACTTGAATGCAATCGAGGAGCC

TGCTGACTCCCTGGCTAGGTTGTTCCCTAATCTGCGGTCCATCAGCCTCCACAAGTCAG - UNI18052 - GTTTGCAGTCCTGGGAAGACATTGACA

AACTAAATTCATTCCCCAAGCTTGAAGAAGTGAGATTGCTAGGAATTCCTCTTCTACAGCCGTATACCACCGAGGAACGCAGGAAATTGGTGGTGGCCAG

 ATTGCCCTCCGTTTCCAAACTCAATGGCAGTGTTGTGACGGATGGTGAGCGAGAGGATTCCGAGAGGTTTTTCATCCGGTACTACGTGGATGTTCCTCA

GGAGGAAGTGCCATTCAG - UNI19632 - GTATCATGAGCTCATTACAAAATATGGGAAATTGGAGCCTTTGGCAGAAGTGGACCTAAGACCCCAGA

GCAGTGCGAAAGTAGAAGTTCACTTCAATGACCAAGTGGAGGAAATGAGCATCCGCCTGGACCAGACAGTAGCCGAACTGAAGAAACAGCTAAAGACCCT

GGTGCAGTTGCCCACCAGCAGCATGCTTCTCTACTACTTTGACCACGAGGCCCCGTTTGGCCCAGAGGAGATGAAGTACAGCTCCCGGGCACTGCACTCC

TTTGGCATTAGGGATGGAGATAAAATTTTTGTGGAATCAAAAACAAAATAACCTCTACCAGCCTTGTAAAAACTCACATAAGGACTTCCTGCAGGGTGTT

TGTTTCCAGCGTGCTTTTCTTTAGGAGGAAGGACTTTTCCATTTTGTTTTGGGTTTTGTTTAGCTTTGGAGGGGTTTTGTATATTTTCTTCCCCTAGAAT

GGATAGGTTTTTGGTATTTTCTACCACAGATTTTTTCAGATCAGTTAGCAGACATGGCTGCATCTCCAGTCTTTATGTGAGAGCATGCCTGTCTCCCTCT

CTCCCTCCCCCTCCTCCTCCCTCTTCCCCCCCTCTCCCCTACCCCCCAAAGATGACAGAAACCACCGGCTTCTTACTGTGTCATTGGGATTTGTCAGCCA

CTGGGCTCTTTCCTGCTAAGCCCAAAGACAGTGTGGTCCCTCAGAGGGGTGATGCAGTGTTCACATCCAGAGATGGGGTCCTCCTAGGGAGGGATGGGGC

TCCTCCTAGGGAGGGATGGGGTCCTCCTAGGGAGGGATGGGGGTCCTCCTAGGGAGGGCCTTCTCTGGCTCTTCCTTCCCTGCCCCTCCTCCTCCTCCTT

TCCATTTGGGGGTCCTGGGTCTGGTTTTCATTCTGACTTGTACCCACTTACCTGGTAGTTTTACTCTGTTCATAATTTAACTTGGTTTTGTTGTTGGTGT

GTCTGTTTTTCCCCCTCTCGTTCCCAGTTTTAAGTGACTTTGAGTATTTTAAGCATTTCCAGTCTGATTCTGATCTCAGGAACTCGGTTAGGTTTTAGAG

AGAAGTAGGCGGAGTGTTAGCCCTGGGAAACTCGCTACTCCCCTGGAAGCCTGCGCTGGGCATTCTAACCGCTCCAGCACCTCTGCGCCCCAGGAGCCCC

TCCAGGGTAGATCAGCTGTCACTCCCGTCACCTGGCACTCGTCCTGTTCTAGGGGTTTTTTCTTCATGTTCAATGAATGTACTTCCTGACAGCTTTATCG

CATAAGCTATTGGAAATGAAGGAAGAGTTGTAGATACTCACTCCTTAGCAGAACATGGGCTGAGAAGCTGGCCAGGAGTGTGAAGCAAGTGGTGGGACTG

GGGAGAAAGCTTGCAGGCTTTCCACCTGTGCGGCATCCTTGTGAAGGAAGCGGCGCTCTCGGCTCTCTAACGGGAGAGATTTAATCACAGGGAGCTGAGG

CCCACCTTTTTCTTGGGACTTTGTGATGATGCGTCTGAACAACTCTTTTTGTTTTGTATTTTATGTCCCCCGTGGAATGATTTTTGCCTAATCTGTGAGT

GAACTTTCAGTGTCACCCCCCCAGGTGTTTTTTGCAGGGGTGTGTGTGTATAAAGCACTTGACCTTTGACACAGCCCCTCACCTACTCTCCTATTCTGAA

ATCTTTTTCTTTGGCCTTCCATTCTTTGTTAATCTGGATGGTTTCCTTGCTGTTTCTATTTAGTTCTGTTCTAGTTCTTGTTTTGTTCTGGCTTTTAACA

TTTGATATGTGATTCCCCCCCTCCTCCAAACTTACTGTGGAGTAAACGCTTTAGGTGACCCATGTGACCTCTTCACGGATGGGAGGTGTAGTCTTTAAGT

TCCCTCCTCCGCCATGTGGCAGGTGTTTGCTCTCTTGCCACCGCACTTCAGGTTCAGCATCTCTAAGGCTGCTGCCCCGGGCCTCCTGAGGCAGGCCCGA

ATTCACTGCAGCACTAAGGGTGAAAGCCAAAGGGTTTAGAAAGATGAATGAAGCCGGGTCTCCTGCTGCAGACTTTGTCTCAGAATCCTAAAAAAAGAAA

AAGAAAAAAGAAAAGAAAAATGAGCAGCGGGGATCAGGCCAGTATAGACGAGGACAGTTATTTTGCAATTGCATTTTCTTGACAGAGTTTTGGAAATAGA

AAAAAAAAAAGAGTATGGCAGCCGTGTCCCGAGGATGAAGATTGGTTGCTTTGTGTATGTGCGTGCGAGTGCGGAGGAATTTGCAAGAGAAACTGTAATG

GAGACGTTGCTTTGTCAGCCTGGGAAACAGTTGCACTCTTATTTTTGAACTTTGGAGCCACTGTTGTCCCAGGGCAGAAGGCAGAGTGAGCGCTTACACT

TTGGTCACAATGAGATATTTTCTATATGACAGAGTTCTCTGAGAGGCTTTTTTACGCTTTGAAACTCGTATCTTCTGTTATTACTCAACAGTGTTTCTCT

GCTGCAGGCCTAATCCTTTATTACAGCTGCGTGGAAAAGGAGTCTCATCCAACCCAACCGGCGTGGGTGTTTCCAGAGCATTGTCATTGGCGGTTTGAAT

AATTGCCGAATCTTTTCCAATTAAGAAAATCTTAAGTACAGTCCTTGGCCTTTTAGAATTAACAGCAGTAAATGAGGAAGCCGTTTGCGCATGCGTCTTT

CCAGATTCACTTGGGTGGCTGAGGAAAGAAGCTGGTTTTGAAATAAAATCGGTGCTGTGTAGACATTTATAACCAAAATTATTTTTATAACAGACCCAGA

AGGAGGAGAGAAAAGACCGTGGACCTTTGAGCCTGCATGTTATCCGTCGTGCTTGTTTGTATGTAACATTGATTTCATCAGATTGAGTGGAAGCATATGG

TTGGCAGTTAGGAGGCGAAAAGCTGCCCTCGCTGGTATACAGAGCGCGCCTTGGGCACGGCAGGGAGAACATGCCTTTCTAAAGCAGAAAGTCTTTTCGG

TTGTGGGGAAGGAAAGGAGTAACACGAGAAAGCCAAACCTAAGCCCAGGGTCCTCCTGTGGGCAGAGCTGCTGAAGCTGTGCTCCAGAGGGATCTCTTAG

TTTGGGTTGTTGAGATACCCTGGATTGTTTTAAATCGGGGGAGTCCACAGTTGCCTGTGTCTGCAGCCCATTGCCATAAATGCACAAGACAGCAGCAGAG

CTGAACGCCCCTTGTTCTTAGAGACCCTCTGGTGAAAATGAAGCCACGTAGCCGAGGGCTGCAGTGCTACCCCGAGAAAAAGAAGGAGCTGTGTGAGGGA

ACGAAGAGCAGATGCAGTTCCAACTGGGATTTTCAGCAATGTCACCCTACCGGCCCTGCTGGGAGCAGAGAACACTTGGTTGTGCAGTATTGGTCACCAC

GGGAGCCTTGCCACCAATAGCTTTTCCTAACACATGTGAGTGTGGCTCTCCCTCCGCACTGTAGCTTAGGCCCTGGGCAAGTAGGGCGTGACTCCAGAAT

GCTCTGTAGTTTGTATGTACGATAATTTCTGTTTATGAATTTCACTTTTCCTTTCATTTCATGTAAAACTAAAATGCAAACAATCTGCTTTCAAGAATGC

CCAGAAGCTCTGTGTCCCCAACTGTTGTTGTGAACTCTACCATTTCTCATAGGTGCTTCCTTAAAATGTATGTTTATTCTAGTGACCGAGAGGGGACTGG

ACTCTCAGGCCCTTTACAGTTGTCTCCTGCAGTTAATGGAAATATAAATATATATATATATTTTATTTTAGAATATAATTTAAACATGAAGGTCTATTCT

TTGCACTTTTTATTAATATATATAGAGAGAGAATCTTTAAAAAAATTAAAAATACAAGTCCATTT
Translation
 - UNI14671 - - UNI22778 - - UNI29651 - MDQPSGRSFMQVLCEKYSPENFPYRRGPGVGVHVPATPQGSPMKD - UNI14671 - -

 UNI21525 - DRLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHE VSKIVSNVPQLEFLNLSSNPLSLSVLERTCAGSFSGVRKL

VLNNSKASWETVHTILQELPE ELEELFLCLNDYETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPADSLARLFPNL

RSISLHKSG - UNI18052 - GLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVAR RLPSVSKLNGSVVTDGEREDSERFFIRYYVDVP

QEEVPFR - UNI19632 - RYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSSMLLYYFDHEAPFGPE

EMKYSSRALHSFGIRDGDKIFVESKTK
Transcript ENSMUST00000066179
Sequence
AAGTGTCAGTGTGTTTTTCAGAGAGTGGCTGTGTGAAGTTCTAGGCTTTAAAACGATTGTTAATCTCGGCGTGGAGACATAGGTGTGGGGACATGGCTTC

AGAAGTAAACGCGTCTAGCCCTGCTCTGA - UNI14671 - - UNI22778 - - UNI29651 - ACTTTTCAGAAAAGAAGATGGACCAGCCTAG

TGGGAGAAGTTTCATGCAAGTATTGTGTGAAAAATACAGTCCTGAAAACTTCCCTTACCGCCGTGGCCCTGGGGTGGGAGTCCATGTCCCAGCCACTCCC

CAGGGCTCGCCTATGAAAG - UNI14671 - - UNI21525 - ATCGCCTCAACCTCCCGAGCGTGCTCGTGTTGAACAGCTGCGGCATTACCTGCG

CGGGAGATGAAAGAGAAATCGCAGCCTTCTGTGCTCACGTGTCAGAACTCGATCTTTCTGACAACAAGCTCCAAGACTGGCATGAG GTCAGTAAGATTG

TGTCAAATGTTCCTCAGCTGGAGTTTCTAAACCTGAGTTCCAATCCTCTGAGTCTGTCAGTTCTAGAAAGAACATGTGCTGGGTCCTTCTCTGGGGTTCG

CAAACTTGTCCTCAACAACAGCAAAGCATCATGGGAAACAGTGCACACCATACTGCAGGAGTTGCCAGA GTTGGAGGAGCTCTTCCTGTGCCTTAATGA

CTATGAAACAGTGTCTTGTCCTTCTGTCTGCTGTCATTCCCTCAAGCTCCTACACATCACAGACAACAACCTCCAAGACTGGACTGAAATCCGAAAGCTG

GGTGTAATGTTTCCTTCACTGGATACCCTGGTCCTGGCCAACAATCACTTGAATGCAATCGAGGAGCCTGCTGACTCCCTGGCTAGGTTGTTCCCTAATC

TGCGGTCCATCAGCCTCCACAAGTCAG - UNI18052 - GTTTGCAGTCCTGGGAAGACATTGACAAACTAAATTCATTCCCCAAGCTTGAAGAAGTG

AGATTGCTAGGAATTCCTCTTCTACAGCCGTATACCACCGAGGAACGCAGGAAATTGGTGGTGGCCAG ATTGCCCTCCGTTTCCAAACTCAATGGCAGT

GTTGTGACGGATGGTGAGCGAGAGGATTCCGAGAGGTTTTTCATCCGGTACTACGTGGATGTTCCTCAGGAGGAAGTGCCATTCAG - UNI19632 - 

GTATCATGAGCTCATTACAAAATATGGGAAATTGGAGCCTTTGGCAGAAGTGGACCTAAGACCCCAGAGCAGTGCGAAAGTAGAAGTTCACTTCAATGAC

CAAGTGGAGGAAATGAGCATCCGCCTGGACCAGACAGTAGCCGAACTGAAGAAACAGCTAAAGACCCTGGTGCAGTTGCCCACCAGCAGCATGCTTCTCT

ACTACTTTGACCACGAGGCCCCGTTTGGCCCAGAGGAGATGAAGTACAGCTCCCGGGCACTGCACTCCTTTGGCATTAGGGATGGAGATAAAATTTTTGT

GGAATCAAAAACAAAATAACCTCTACCAGCCTTGTAAAAACTCACATAAGGACTTCCTGCAGGGTGTTTGTTTCCAGCGTGCTTTTCTTTAGGAGGAAGG

ACTTTTCCATTTTGTTTTGGGTTTTGTTTAGCTTTGGAGGGGTTTTGTATATTTTCTTCCCCTAGAATGGATAGGTTTTTGGTATTTTCTACCACAGATT

TTTTCAGATCAGTTAGCAGACATGGCTGCATCTCCAGTCTTTATGTGAGAGCATGCCTGTCTCCCTCTCTCCCTCCCCCTCCTCCTCCCTCTTCCCCCCC

TCTCCCCTACCCCCCAAAGATGACAGAAACCACCGGCTTCTTACTGTGTCATTGGGATTTGTCAGCCACTGGGCTCTTTCCTGCTAAGCCCAAAGACAGT

GTGGTCCCTCAGAGGGGTGATGCAGTGTTCACATCCAGAGATGGGGTCCTCCTAGGGAGGGATGGGGCTCCTCCTAGGGAGGGATGGGGTCCTCCTAGGG

AGGGATGGGGGTCCTCCTAGGGAGGGCCTTCTCTGGCTCTTCCTTCCCTGCCCCTCCTCCTCCTCCTTTCCATTTGGGGGTCCTGGGTCTGGTTTTCATT

CTGACTTGTACCCACTTACCTGGTAGTTTTACTCTGTTCATAATTTAACTTGGTTTTGTTGTTGGTGTGTCTGTTTTTCCCCCTCTCGTTCCCAGTTTTA

AGTGACTTTGAGTATTTTAAGCATTTCCAGTCTGATTCTGATCTCAGGAACTCGGTTAGGTTTTAGAGAGAAGTAGGCGGAGTGTTAGCCCTGGGAAACT

CGCTACTCCCCTGGAAGCCTGCGCTGGGCATTCTAACCGCTCCAGCACCTCTGCGCCCCAGGAGCCCCTCCAGGGTAGATCAGCTGTCACTCCCGTCACC

TGGCACTCGTCCTGTTCTAGGGGTTTTTTCTTCATGTTCAATGAATGTACTTCCTGACAGCTTTATCGCATAAGCTATTGGAAATGAAGGAAGAGTTGTA

GATACTCACTCCTTAGCAGAACATGGGCTGAGAAGCTGGCCAGGAGTGTGAAGCAAGTGGTGGGACTGGGGAGAAAGCTTGCAGGCTTTCCACCTGTGCG

GCATCCTTGTGAAGGAAGCGGCGCTCTCGGCTCTCTAACGGGAGAGATTTAATCACAGGGAGCTGAGGCCCACCTTTTTCTTGGGACTTTGTGATGATGC

GTCTGAACAACTCTTTTTGTTTTGTATTTTATGTCCCCCGTGGAATGATTTTTGCCTAATCTGTGAGTGAACTTTCAGTGTCACCCCCCCAGGTGTTTTT

TGCAGGGGTGTGTGTGTATAAAGCACTTGACCTTTGACACAGCCCCTCACCTACTCTCCTATTCTGAAATCTTTTTCTTTGGCCTTCCATTCTTTGTTAA

TCTGGATGGTTTCCTTGCTGTTTCTATTTAGTTCTGTTCTAGTTCTTGTTTTGTTCTGGCTTTTAACATTTGATATGTGATTCCCCCCCTCCTCCAAACT

TACTGTGGAGTAAACGCTTTAGGTGACCCATGTGACCTCTTCACGGATGGGAGGTGTAGTCTTTAAGTTCCCTCCTCCGCCATGTGGCAGGTGTTTGCTC

TCTTGCCACCGCACTTCAGGTTCAGCATCTCTAAGGCTGCTGCCCCGGGCCTCCTGAGGCAGGCCCGAATTCACTGCAGCACTAAGGGTGAAAGCCAAAG

GGTTTAGAAAGATGAATGAAGCCGGGTCTCCTGCTGCAGACTTTGTCTCAGAATCCTAAAAAAAGAAAAAGAAAAAAGAAAAGAAAAATGAGCAGCGGGG

ATCAGGCCAGTATAGACGAGGACAGTTATTTTGCAATTGCATTTTCTTGACAGAGTTTTGGAAATAGAAAAAAAAAAAGAGTATGGCAGCCGTGTCCCGA

GGATGAAGATTGGTTGCTTTGTGTATGTGCGTGCGAGTGCGGAGGAATTTGCAAGAGAAACTGTAATGGAGACGTTGCTTTGTCAGCCTGGGAAACAGTT

GCACTCTTATTTTTGAACTTTGGAGCCACTGTTGTCCCAGGGCAGAAGGCAGAGTGAGCGCTTACACTTTGGTCACAATGAGATATTTTCTATATGACAG

AGTTCTCTGAGAGGCTTTTTTACGCTTTGAAACTCGTATCTTCTGTTATTACTCAACAGTGTTTCTCTGCTGCAGGCCTAATCCTTTATTACAGCTGCGT

GGAAAAGGAGTCTCATCCAACCCAACCGGCGTGGGTGTTTCCAGAGCATTGTCATTGGCGGTTTGAATAATTGCCGAATCTTTTCCAATTAAGAAAATCT

TAAGTACAGTCCTTGGCCTTTTAGAATTAACAGCAGTAAATGAGGAAGCCGTTTGCGCATGCGTCTTTCCAGATTCACTTGGGTGGCTGAGGAAAGAAGC

TGGTTTTGAAATAAAATCGGTGCTGTGTAGAC
Translation
MASEVNASSPALN - UNI14671 - - UNI22778 - - UNI29651 - NFSEKKMDQPSGRSFMQVLCEKYSPENFPYRRGPGVGVHVPATPQGS

PMKD - UNI14671 - - UNI21525 - DRLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHE VSKIVSNVPQLEFLNLSSNPL

SLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPE ELEELFLCLNDYETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANN

HLNAIEEPADSLARLFPNLRSISLHKSG - UNI18052 - GLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVAR RLPSVSKLNGSVVT

DGEREDSERFFIRYYVDVPQEEVPFR - UNI19632 - RYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQL

PTSSMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIFVESKTK

For any suggestions or comments, please send an email to unitrap@crg.es