Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037307 (Banf2)
Chromosomal location
Chr 2: 143858838 - 143899715 (+)
Description
barrier to autointegration factor 2 Gene [Source:MGI (curated);Acc:Banf2-001]
RefSeq_dna
NM_207275 NM_001044750 
RefSeq_peptide
NP_997158.1 NP_001038215.1 
MGI
MGI:2684961 
Uniprot/SWISSPROT
Q8BVR0 
Uniprot/SPTREMBL
A2ATM8 
Human Ortholog
ENSG00000125888 (C20orf179)
Omim not available
UniTrap UNI16736
Vector Insertion
Chr 2: 143891140 - 143891270
Public Clones not available
Private Clones OST455329 (lexicon) OST118880 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13829
Vector Insertion
Chr 2: 143899502 - 143899714
Public Clones CMHD-GT_229C8-3 (cmhd) CMHD-GT_208F12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037722
Sequence
GCATTGAGCTTACCCGCCGTTACAGATCCCAGTAAGAAGCCTGCTACTGCCTGACCAAGTGCACCGG GGTCTGCTGACAGACAGGACCCTTGAAAACCA

GCTTTCAGATCCGTCTTTTCTCCAAGGCATACCAATACGAACAGGAGGATAAGAAGGCAAACGAGAGAAGATCTGCTTCGAAGAAAG - UNI16736 -

 AAGATGGACGACATGTCGCCCAGGCTGAGAGCCTTTCTCTCTGAACCCATTGGGGAAAAGGATGTGGCCTGGGTGGATGGCATCAGCCGTGAACTTGCC

ATCAATTTGGTCACCAAAGGTTTCAACAAG - UNI13829 - - UNI16736 - GCCTATGTCCTGCTGGGACAGTTTCTTCTGATGCACAAGAATG

AAGCAGAGTTCCAGAGGTGGATCATCTGCTGCTGTGGAGCTACGGAGTGTGAGGCCCGCCAGAGCTCCACCTGCCTGAAGGAGTGGTGCTCCTGTTTCCT

ATAGATATCTCTGGCCTGGCAGCTCTACCTCAGATAAAGGCTACCCATGCTACCTACAGACAACCTCC
Translation
  - UNI16736 - MDDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNK - UNI13829 - - UNI16736 - AYVLLGQFLLMHKNEA

EFQRWIICCCGATECEARQSSTCLKEWCSCFL
Transcript ENSMUST00000110032
Sequence
GCATTGAGCTTACCCGCCGTTACAGATCCCAGTAAGAAGCCTGCTACTGCCTGACCAAGTGCACCGG - UNI16736 - AAGATGGACGACATGTCGC

CCAGGCTGAGAGCCTTTCTCTCTGAACCCATTGGGGAAAAGGATGTGGCCTGGGTGGATGGCATCAGCCGTGAACTTGCCATCAATTTGGTCACCAAAGG

TTTCAACAAG - UNI13829 - - UNI16736 - GCCTATGTCCTGCTGGGACAGTTTCTTCTGATGCACAAGAATGAAGCAGAGTTCCAGAGGTGG

ATCATCTGCTGCTGTGGAGCTACGGAGTGTGAGGCCCGCCAGAGCTCCACCTGCCTGAAGGAGTGGTGCTCCTGTTTCCTATAGATATCTCTGGCCTGGC

AGCTCTACCTCAGATAAAGGCTACCCATGCTACCTACAGACAACCTCCAA
Translation
 - UNI16736 - MDDMSPRLRAFLSEPIGEKDVAWVDGISRELAINLVTKGFNK - UNI13829 - - UNI16736 - AYVLLGQFLLMHKNEAE

FQRWIICCCGATECEARQSSTCLKEWCSCFL

For any suggestions or comments, please send an email to unitrap@crg.es