Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037315 (Phf16)
Chromosomal location
Chr X: 20002928 - 20097063 (+)
Description
PHD finger protein 16 Gene [Source:MGI (curated);Acc:Phf16-001]
RefSeq_dna
NM_199317 
RefSeq_peptide
NP_955021.1 
MGI
MGI:2148019 
Uniprot/SWISSPROT
Q6IE82 
Uniprot/SPTREMBL
A1L3T5 B1AV39 
Human Ortholog
ENSG00000102221 (PHF16)
Omim not available
UniTrap UNI33180
Vector Insertion
Chr X: 20002957 - 20006148
Public Clones IST13763A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36330
Vector Insertion
Chr X: 20006258 - 20012336
Public Clones IST12422B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2076
Vector Insertion
Chr X: 20039318 - 20056639
Public Clones XT0269 (sanger) RRH047 (baygenomics) RRH203 (baygenomics) IST12276F5 (tigm)
IST14132A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34838
Vector Insertion
Chr X: 20056798 - 20066827
Public Clones IST11595D3 (tigm) IST11786D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI408
Vector Insertion
Chr X: 20067019 - 20071282
Public Clones GC1451 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043693
Sequence
AAGGAGCGGAGCGAGACGCTGCGCCGGAG - UNI33180 - GTCTTTCCATAGACAACAGAAGCAAGGCTCCTATAATCAAAAGTGCCTCTTTGCTGA

GTCATTGGGAAAAACTTGTCTGATCCAATCTGCTAGACTTGGAAAAGGGGAG - UNI36330 - TGACGAATCCAGCATCATACTGTGGAGTGGCCAA

GATCTACCAGTGTGGGGGCATCAGACTTTGACCTTACGTTGGAAGATCTCAGAG GATGCACCATGATGAAACGGCATAGACCTGTCAGCAGCAGTGAGA

GTTCAGATGAGT GTCCTTCCACTTCCTTTACTTCTAGCTCAATGTATAGGAAGAAGTCAAAAAATCCTAAGGAACAGAAGAAGTCTGCTGAG - UNI2

076 - GTATTCCGAAAGGACCTCATCAGTGCCATGAAAATTCCTGACTCTCACCATGTTAATCCTGACAGCTATTACCTCTTTACTGACACATGGAAAG

AAGAATGGGAAAAAGGAGTCCAAGTACCAGCCAATCCAGACTCTGTTCCAACGCCGTCTCTCAG - UNI34837 - GATTATATCTGAAAAAGTAAAG

GAGATGCTTTTTGTCCGGCCCCGGAAATATATCCGTTGCTCCAGCCCAGAGTCTGCAGAACCTGGCTATATCAATACCCTGGAGCAAGCAGCATCTACAT

GCCGCTATGACCTAGATGACATGGATATCTTTTGGCTTCAGGAACTCAATGAAGACCTTGGAGAAATGG - UNI408 - GTTATGGCCCAATTGATGA

GACTCTTATGGAAAAGACAATAGAAGTTCTGGAACGCCACTGCCATGAAAATATGAACCATGCTATTGAAACAGTGGAAGGGCTAGGAATAGAATATGAT

GAAGATGTGATCTGTGATGTGTGCCGGTCTCCAGACAGTGAAGAAGGGAATGATATGGTATTCTGTGATAAGTGTAACGTCTGTGTACATCAG GCTTGC

TATGGCATTCTCAAGATTCCAGAAGGTAGTTGGCTGTGCCGCTCCTGTGTCCTGGGCATTTATCCACAGTGTGTTTTATGTCCTAAGAAAGGTGGAGCCA

TGAAGACCACCAGAACAGGGACTAAATGGGCTCATGTCAGCTGTGCCCTGTGGATTCCAGAA GTCAGTATCGCTTGTCCTGAGAGAATGGAGCCTGTCA

CAAAAATCTCCCATATCCCACCTAGCCGGTGGGCCTTAGTTTGCAACCTGTGCAAGTTGAAGACAGGGGCTTGTATTCAG TGCTCTGTGAAAAGCTGTA

TCACTGCCTTTCATGTCACCTGTGCCTTTGAGCACGGCCTGGAAATGAAGACCATCCTAGATGAGGGGGATGAAGTAAAGTTCAAGTCATTTTGCCTCAA

GCATAGCCAAAACAAGCCAAAACTTGGGGACGCCGAGTACCACCACCACAGAGTCGCCGAGCAGAGCCAGGCAAAAAGTGAGAAAACCAGCCTACGGGCA

CAGAAGCTTCGTGAACTAGAAGAAGAATTCTATACCTTAGTCCAGGTAGAAGATGTTGCCAAAGAGATGGAGTTATCTGCGTTCACTGTCGATTTTATCT

ATAACTACTGGAAACTAAAGCGCAAAAGCAACTTCAATAAGCCATTAATTCCCCCAAAAGAAGAGGAAGAAAATGGCTTGGTTCAGCCAAAAGAAGAAAG

CATTCACACTCGGATGAGAATGTTTATGCATCTGCGGCAGGACCTTGAGAGG GTCCGAAATCTGTGCTACATGATAAGCAGACGAGAGAAGCTGAAACT

ATCACACACCAAAGTGCAGGAACAGATTTTTGGTTTGCAAGTCCAGCTTATCAATGAAGAAATTACAGAAG GACTTTCTTTGACAAATGCACTAGAGAA

CTCACTGTTTTATCCACCACCACGAATTACCTTAAAGTTAAAAATGCCTAAATCAACCTCAGAAGATTGCAAAGACAGCTCCACAGAAACTGAACACCAA

CTCTCGTCTCCTGGCAGCAGCTCCCCTGGTCACAGTAAAAGGAGCCCTCAGATGCCTGAGGAACCACTGGATATGAATGTGAAAATATATCCAAGATATC

CACTAGAAAGCAAAAGTAACTGTTTGCAGACTAGCCGAAGCCATTCTCGATGTGAAACCAAGAGCTCCAGTCCTACTCCGAGAGCTCCATCTGCAGAATT

CTATCATGGGCAATCACTAGGGAAGCCTCTGGCCCTTCAGGCTGCCCTCCATGGACAGGTGTCTATTGGTAATGGGAAGAATCAGCCTAACTCCAGGGTT

TCTAGTTCCAATGGCCTGGAGGGCAACTGGTCTGGGAACATCACCCAGAAAGTTAATTCAAGTGAGGTGTGCTATGACCAGGAGTCCATGCTCAGCTCCC

ACTTACCCAGTCCAGGCAACATTAGAAAATCTAGCATGGAACATTTCAGCAGGTCCTTCAAGGAGGCCACCAATACATGGGTGAAGCCTACTGAGGACCT

CCAGTACTGTGTTAAGCCAACTAAGAATGTGAGCTCTAAGGAGCAGTTGTGGGGTAGACAGCTTCTCAGGCGTCCCACAGGAAGAGCTTCATATCAGGAA

ACTGATGGCTATTGCCCTGATTTGGAGCCCAGTGATTCAGAAGCAGAAGGGGAGGGGAGTAAAGAAACACCAAGGGTAAAGAGAGAGAGTTCTGACAGAG

AAAATCCTTCCCATGATTCTGCTCGGGAGTGCCATGGGAAAACCAAGACACACCCTCATTCCCACAGCTCAATGCAAAGGTGATCAGAAACGCCTAAGAG

TAACCCAGCCTTTGCCCCGTATACTGGGGGAAATATAAACACCAAAAGGATTCTAGTATATATTAGGGGGAATTGCAGGGAAAATGATGGTTTGAAGTTT

TTGAAAGCATTTCAGGTCTAGTTTTTATAAGCACATTACAAGAGTTGCAGATTGTCTGGGGTTGCTTTGTCGGAGGCTGCTGGGAACAGTTGGGCCCAGA

GTATTTGCTCAGTTAGTACTTCAGGGCAGCTTTCCCGTTACATTAACACACTGATTAATCTACATACTAAGAATCCTTGCATTGTCAATGGATTTGCAAG

AGGATGTGACAGACACTAAAACTACTTATCTTTTGAAACTATAACATGTGACTCCTTGAAGCTCAAATCTAGAAAATTTCTAATTCCACTGGTATCTGTA

AAACCTTCAAGAGAGAGACCAGGAGAGCAACAGTCTCAGATACTGACTCTTACTGTTGTCTTCCTTGCTTCATGCAAGGTTGAGTTTCTTTCACAGTATC

CTATCTTCCAAAGTCAGTTCTTGTAGGTGTCCAGTGCCTGTTCCTAGACCTACTTCTTGGGGACACATTCATAACTCTCTTATCCAGCTAACAAGCTAAC

TTGTGAATAGTGTTTACAAAAGTACAGAAGTACTACTTCCAAGGAAAATGCTCTGCTTCTCAAGGCATTTGTGAAGATGTCCAGAACATTTCCCAAAGTG

TGACCTTTTCTGGTATATTTGTACCAGGTCAGGGTTTTTTTCTGTTGTTTTCAAATAAGTTTGAGTAAAGTTTGGCTGACAGTTTTTGTATACCTGCTTT

AATGTTTATAAAATTTTTATTGAGGAATAATTAAGATATAGTGTAATACACAGAGGCTTAAGTATTCTTAACGTGCTTTAATTTTGAAACAGATTTTTAT

TGTCAGAAATTTGAAAGCATGTGTTCAGCACATGGATATAATTTAGCTTTTTATGAATTTTAAATCCAAGGCCATTTCCCAAGCATAAAAGTTGGAGCCA

TTTTTCAGAACTTGCTTATACCACATTACCAAATAATCAGCCTTGATTCATTTCTAGACGAAGAGAATTTTGAAGCAGGGGATAAAACAAGTCTGCTTCC

CCTTTAAGCAAAAGGAGAAAGTAACAGTTTATAAACATGTGTGAGGCAGACTGTAATTCTCAGCTTCCTTTTCTTCTTAGCCTTAAAATAATATTCTCTT

TCTTCTAGTTCGGGAACATATAGAGAGAATTTTCAAACAAGAGGCCATTTTCAATTTCTGAAGTTTCATGCTAGTGAAAGAAGCCAGCTGCAGTAGGTGC

CAGTGCTATGGAGCTAGAAAACTCAGCAGTTTGCCTCTGCTTCACTTTCATTCCTAGAACCTCATTAAAGGTTTCTTTGGGGTTTTGTTTTCTCCTGTTT

TGAAATTTTGTGTATTTTGCCTCTCTTTTGGCTGCATCTTCAAAATAATTCCTTTTGTGCCTATGAACATGTGTGAACAGACCATAACATGAATAATAGG

TGTCCTGTATTTTCTTTTAGTTGAAAACATGAGGGAGAGAATTTCCTTTCTTCATACCCTCAGCTTCTGTGCTTATTTGAATACTCATAGGGTACATATA

AATTTAACACTTTCATGGTAATGAGTATAATGAAGCTGAGTTGTAAATTCCTTAAAGGCCAACAGGTTGCCTGTGTCCTTTCATGCTTTTGAATTCTGAG

GCAGGGGAGCAAACATGGAAACAGTGCTTTAGCCAAATTCCATATGTAATGCCATTGGAAGAGTATTGCCTGAAAAATTCAAGTCAGGGAGATAAAATGG

TAACTTTTTTAGAGAATTTTCCTGGGTAAACAAATGAGCCAGCCTTCCATTGTATACATTCCAAATGCCCCAAGCATCTGCTACATTTTGTTCTTTGAAG

TATTACCTCTTAACCTTTGTTAATGTTTTTTGTCTTGTCTTATAAAAGTTTTGAAGATGAACTCAATCTTTTTTCAAATGTCACCTTTTTATCAATACTT

TTTCATTAAATTATGAAAACTGTT
Translation
 - UNI33180 -  - UNI36330 -  MKRHRPVSSSESSDEC CPSTSFTSSSMYRKKSKNPKEQKKSAE - UNI2076 - VFRKDLISAMKIPD

SHHVNPDSYYLFTDTWKEEWEKGVQVPANPDSVPTPSLR - UNI34837 - RIISEKVKEMLFVRPRKYIRCSSPESAEPGYINTLEQAASTCRYDLD

DMDIFWLQELNEDLGEMG - UNI408 - GYGPIDETLMEKTIEVLERHCHENMNHAIETVEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVH

Q ACYGILKIPEGSWLCRSCVLGIYPQCVLCPKKGGAMKTTRTGTKWAHVSCALWIPE VSIACPERMEPVTKISHIPPSRWALVCNLCKLKTGACIQ C

SVKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKSFCLKHSQNKPKLGDAEYHHHRVAEQSQAKSEKTSLRAQKLRELEEEFYTLVQVEDVAKEMELSAF

TVDFIYNYWKLKRKSNFNKPLIPPKEEEENGLVQPKEESIHTRMRMFMHLRQDLER VRNLCYMISRREKLKLSHTKVQEQIFGLQVQLINEEITEG GL

SLTNALENSLFYPPPRITLKLKMPKSTSEDCKDSSTETEHQLSSPGSSSPGHSKRSPQMPEEPLDMNVKIYPRYPLESKSNCLQTSRSHSRCETKSSSPT

PRAPSAEFYHGQSLGKPLALQAALHGQVSIGNGKNQPNSRVSSSNGLEGNWSGNITQKVNSSEVCYDQESMLSSHLPSPGNIRKSSMEHFSRSFKEATNT

WVKPTEDLQYCVKPTKNVSSKEQLWGRQLLRRPTGRASYQETDGYCPDLEPSDSEAEGEGSKETPRVKRESSDRENPSHDSARECHGKTKTHPHSHSSMQ

R
Transcript ENSMUST00000115384
Sequence
AAGGAGCGGAGCGAGACGCTGCGCCGGAG - UNI33180 - GTCTTTCCATAGACAACAGAAGCAAGGCTCCTATAATCAAAAGTGCCTCTTTGCTGA

GTCATTGGGAAAAACTTGTCTGATCCAATCTGCTAGACTTGGAAAAGGGGAG - UNI36330 - TGACGAATCCAGCATCATACTGTGGAGTGGCCAA

GATCTACCAGTGTGGGGGCATCAGACTTTGACCTTACGTTGGAAGATCTCAGAG GATGCACCATGATGAAACGGCATAGACCTGTCAGCAGCAGTGAGA

GTTCAGATGAGT GTCCTTCCACTTCCTTTACTTCTAGCTCAATGTATAGGAAGAAGTCAAAAAATCCTAAGGAACAGAAGAAGTCTGCTGAG - UNI2

076 - GTATTCCGAAAGGACCTCATCAGTGCCATGAAAATTCCTGACTCTCACCATGTTAATCCTGACAGCTATTACCTCTTTACTGACACATGGAAAG

AAGAATGGGAAAAAGGAGTCCAAGTACCAGCCAATCCAGACTCTGTTCCAACGCCGTCTCTCAG - UNI34837 - GATTATATCTGAAAAAGTAAAG

GAGATGCTTTTTGTCCGGCCCCGGAAATATATCCGTTGCTCCAGCCCAGAGTCTGCAGAACCTGGCTATATCAATACCCTGGAGCAAGCAGCATCTACAT

GCCGCTATGACCTAGATGACATGGATATCTTTTGGCTTCAGGAACTCAATGAAGACCTTGGAGAAATGG - UNI408 - GTTATGGCCCAATTGATGA

GACTCTTATGGAAAAGACAATAGAAGTTCTGGAACGCCACTGCCATGAAAATATGAACCATGCTATTGAAACAGTGGAAGGGCTAGGAATAGAATATGAT

GAAGATGTGATCTGTGATGTGTGCCGGTCTCCAGACAGTGAAGAAGGGAATGATATGGTATTCTGTGATAAGTGTAACGTCTGTGTACATCAG GCTTGC

TATGGCATTCTCAAGATTCCAGAAGGTAGTTGGCTGTGCCGCTCCTGTGTCCTGGGCATTTATCCACAGTGTGTTTTATGTCCTAAGAAAGGTGGAGCCA

TGAAGACCACCAGAACAGGGACTAAATGGGCTCATGTCAGCTGTGCCCTGTGGATTCCAGAA GTCAGTATCGCTTGTCCTGAGAGAATGGAGCCTGTCA

CAAAAATCTCCCATATCCCACCTAGCCGGTGGGCCTTAGTTTGCAACCTGTGCAAGTTGAAGACAGGGGCTTGTATTCAG TGCTCTGTGAAAAGCTGTA

TCACTGCCTTTCATGTCACCTGTGCCTTTGAGCACGGCCTGGAAATGAAGACCATCCTAGATGAGGGGGATGAAGTAAAGTTCAAGTCATTTTGCCTCAA

GCATAGCCAAAACAAGCCAAAACTTGGGGACGCCGAGTACCACCACCACAGAGTCGCCGAGCAGAGCCAGGCAAAAAGTGAGAAAACCAGCCTACGGGCA

CAGAAGCTTCGTGAACTAGAAGAAGAATTCTATACCTTAGTCCAGGTAGAAGATGTTGCCAAAGAGATGGAGTTATCTGCGTTCACTGTCGATTTTATCT

ATAACTACTGGAAACTAAAGCGCAAAAGCAACTTCAATAAGCCATTAATTCCCCCAAAAGAAGAGGAAGAAAATGGCTTGGTTCAGCCAAAAGAAGAAAG

CATTCACACTCGGATGAGAATGTTTATGCATCTGCGGCAGGACCTTGAGAGG GTCCGAAATCTGTGCTACATGATAAGCAGACGAGAGAAGCTGAAACT

ATCACACACCAAAGTGCAGGAACAGATTTTTGGTTTGCAAGTCCAGCTTATCAATGAAGAAATTACAGAAG GACTTTCTTTGACAAATGCACTAGAGAA

CTCACTGTTTTATCCACCACCACGAATTACCTTAAAGTTAAAAATGCCTAAATCAACCTCAGAAGATTGCAAAGACAGCTCCACAGAAACTGAACACCAA

CTCTCGTCTCCTGGCAGCAGCTCCCCTGGTCACAGTAAAAGGAGCCCTCAGATGCCTGAGGAACCACTGGATATGAATGTGAAAATATATCCAAGATATC

CACTAGAAAGCAAAAGTAACTGTTTGCAGACTAGCCGAAGCCATTCTCGATGTGAAACCAAGAGCTCCAGTCCTACTCCGAGAGCTCCATCTGCAGAATT

CTATCATGGGCAATCACTAGGGAAGCCTCTGGCCCTTCAGGCTGCCCTCCATGGACAGGTGTCTATTGGTAATGGGAAGAATCAGCCTAACTCCAGGGTT

TCTAGTTCCAATGGCCTGGAGGGCAACTGGTCTGGGAACATCACCCAGAAAGTTAATTCAAGTGAGGTGTGCTATGACCAGGAGTCCATGCTCAGCTCCC

ACTTACCCAGTCCAGGCAACATTAGAAAATCTAGCATGGAACATTTCAGCAGGTCCTTCAAGGAGGCCACCAATACATGGGTGAAGCCTACTGAGGACCT

CCAGTACTGTGTTAAGCCAACTAAGAATGTGAGCTCTAAGGAGCAGTTGTGGGGTAGACAGCTTCTCAGGCGTCCCACAGGAAGAGCTTCATATCAGGAA

ACTGATGGCTATTGCCCTGATTTGGAGCCCAGTGATTCAGAAGCAGAAGGGGAGGGGAGTAAAGAAACACCAAGGGTAAAGAGAGAGAGTTCTGACAGAG

AAAATCCTTCCCATGATTCTGCTCGGGAGTGCCATGGGAAAACCAAGACACACCCTCATTCCCACAGCTCAATGCAAAGGTGATCAGAAACGCCTAAGAG

TAACCCAGCCTTTGCCCCGTATACTGGGGGAAATATAAACACCAAAAGGATTCTAGTATATATTAGGGGGAATTGCAGGGAAAATGATGGTTTGAAGTTT

TTGAAAGCATTTCAGGTCTAGTTTTTATAAGCACATTACAAGAGTTGCAGATTGTCTGGGGTTGCTTTGTCGGAGGCTGCTGGGAACAGTTGGGCCCAGA

GTATTTGCTCAGTTAGTACTTCAGGGCAGCTTTCCCGTTACATTAACACACTGATTAATCTACATACTAAGAATCCTTGCATTGTCAATGGATTTGCAAG

AGGATGTGACAGACACTAAAACTACTTATCTTTTGAAACTATAACATGTGACTCCTTGAAGCTCAAATCTAGAAAATTTCTAATTCCACTGGTATCTGTA

AAACCTTCAAGAGAGAGACCAGGAGAGCAACAGTCTCAGATACTGACTCTTACTGTTGTCTTCCTTGCTTCATGCAAGGTTGAGTTTCTTTCACAGTATC

CTATCTTCCAAAGTCAGTTCTTGTAGGTGTCCAGTGCCTGTTCCTAGACCTACTTCTTGGGGACACATTCATAACTCTCTTATCCAGCTAACAAGCTAAC

TTGTGAATAGTGTTTACAAAAGTACAGAAGTACTACTTCCAAGGAAAATGCTCTGCTTCTCAAGGCATTTGTGAAGATGTCCAGAACATTTCCCAAAGTG

TGACCTTTTCTGGTATATTTGTACCAGGTCAGGGTTTTTTTCTGTTGTTTTCAAATAAGTTTGAGTAAAGTTTGGCTGACAGTTTTTGTATACCTGCTTT

AATGTTTATAAAATTTTTATTGAGGAATAATTAAGATATAGTGTAATACACAGAGGCTTAAGTATTCTTAACGTGCTTTAATTTTGAAACAGATTTTTAT

TGTCAGAAATTTGAAAGCATGTGTTCAGCACATGGATATAATTTAGCTTTTTATGAATTTTAAATCCAAGGCCATTTCCCAAGCATAAAAGTTGGAGCCA

TTTTTCAGAACTTGCTTATACCACATTACCAAATAATCAGCCTTGATTCATTTCTAGACGAAGAGAATTTTGAAGCAGGGGATAAAACAAGTCTGCTTCC

CCTTTAAGCAAAAGGAGAAAGTAACAGTTTATAAACATGTGTGAGGCAGACTGTAATTCTCAGCTTCCTTTTCTTCTTAGCCTTAAAATAATATTCTCTT

TCTTCTAGTTCGGGAACATATAGAGAGAATTTTCAAACAAGAGGCCATTTTCAATTTCTGAAGTTTCATGCTAGTGAAAGAAGCCAGCTGCAGTAGGTGC

CAGTGCTATGGAGCTAGAAAACTCAGCAGTTTGCCTCTGCTTCACTTTCATTCCTAGAACCTCATTAAAGGTTTCTTTGGGGTTTTGTTTTCTCCTGTTT

TGAAATTTTGTGTATTTTGCCTCTCTTTTGGCTGCATCTTCAAAATAATTCCTTTTGTGCCTATGAACATGTGTGAACAGACCATAACATGAATAATAGG

TGTCCTGTATTTTCTTTTAGTTGAAAACATGAGGGAGAGAATTTCCTTTCTTCATACCCTCAGCTTCTGTGCTTATTTGAATACTCATAGGGTACATATA

AATTTAACACTTTCATGGTAATGAGTATAATGAAGCTGAGTTGTAAATTCCTTAAAGGCCAACAGGTTGCCTGTGTCCTTTCATGCTTTTGAATTCTGAG

GCAGGGGAGCAAACATGGAAACAGTGCTTTAGCCAAATTCCATATGTAATGCCATTGGAAGAGTATTGCCTGAAAAATTCAAGTCAGGGAGATAAAATGG

TAACTTTTTTAGAGAATTTTCCTGGGTAAACAAATGAGCCAGCCTTCCATTGTATACATTCCAAATGCCCCAAGCATCTGCTACATTTTGTTCTTTGAAG

TATTACCTCTTAACCTTTGTTAATGTTTTTTGTCTTGTCTTATAAAAGTTTTGAAGATGAACTCAATCTTTTTTCAAATGTCACCTTTTTATCAATACTT

TTTCATTAAATTATGAAAACTGTT
Translation
 - UNI33180 -  - UNI36330 -  MMKRHRPVSSSESSDEC CPSTSFTSSSMYRKKSKNPKEQKKSAE - UNI2076 - VFRKDLISAMKIP

DSHHVNPDSYYLFTDTWKEEWEKGVQVPANPDSVPTPSLR - UNI34837 - RIISEKVKEMLFVRPRKYIRCSSPESAEPGYINTLEQAASTCRYDL

DDMDIFWLQELNEDLGEMG - UNI408 - GYGPIDETLMEKTIEVLERHCHENMNHAIETVEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCV

HQ ACYGILKIPEGSWLCRSCVLGIYPQCVLCPKKGGAMKTTRTGTKWAHVSCALWIPE VSIACPERMEPVTKISHIPPSRWALVCNLCKLKTGACIQ 

CSVKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKSFCLKHSQNKPKLGDAEYHHHRVAEQSQAKSEKTSLRAQKLRELEEEFYTLVQVEDVAKEMELSA

FTVDFIYNYWKLKRKSNFNKPLIPPKEEEENGLVQPKEESIHTRMRMFMHLRQDLER VRNLCYMISRREKLKLSHTKVQEQIFGLQVQLINEEITEG G

LSLTNALENSLFYPPPRITLKLKMPKSTSEDCKDSSTETEHQLSSPGSSSPGHSKRSPQMPEEPLDMNVKIYPRYPLESKSNCLQTSRSHSRCETKSSSP

TPRAPSAEFYHGQSLGKPLALQAALHGQVSIGNGKNQPNSRVSSSNGLEGNWSGNITQKVNSSEVCYDQESMLSSHLPSPGNIRKSSMEHFSRSFKEATN

TWVKPTEDLQYCVKPTKNVSSKEQLWGRQLLRRPTGRASYQETDGYCPDLEPSDSEAEGEGSKETPRVKRESSDRENPSHDSARECHGKTKTHPHSHSSM

QR

For any suggestions or comments, please send an email to unitrap@crg.es