Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037343 (Taf2)
Chromosomal location
Chr 15: 54846684 - 54903707 (-)
Description
TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor Gene [Source:MGI Symbol;Acc:MGI:2443028]
RefSeq_dna
NM_001081288 
RefSeq_peptide
NP_001074757.1 
UniGene
Mm.380957 Mm.407092 
MGI
MGI:2443028 
Uniprot/SWISSPROT
Q8C176 
Human Ortholog
ENSG00000064313 (TAF2)
Omim not available
UniTrap UNI26374
Vector Insertion
Chr 15: 54897576 - 54902947
Public Clones not available
Private Clones OST122669 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1586
Vector Insertion
Chr 15: 54885875 - 54887341
Public Clones CC0068 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9089
Vector Insertion
Chr 15: 54858833 - 54859872
Public Clones XK223 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041733
Sequence
AGAGGTGACCGGCAAGATGTCCGCAGGCGGCGGCGGCCGCTTAGAGCTCCTGTAGCGCGGCTCATCTGTGTGACAGGGGCCGGGCGGAGGCGGCTGAGAG

TGGTCGGGGAGGGGACAGGAGGCGGAGGACGGGTGGCTAGGCGCTCCGGGTGCACGGGCCGCTACCGGGAATGCGCTGCAGCGCCCCGTGCAGCCTGAAA

GGCGAGCCCCGCAGGAGCTCTTCATGCCGCCCACCGGCTTAGAGTCCTCCAGGATGAACAGGAAGAAAGGAGACAAGGGCTTCGAAAGCCCACGGCCGTA

CAAATT AACCCATCAGGTCGTCTGTATCAACAACATAAACTTCCAGCGAAAATCAGTTGTG - UNI26374 - GGATTTGTGGAGCTGACTATATTT

CCCACAGTTGCCAACTTGAATAGAATTAAGTTGAACAGTAAACAGTGTAGAATATACCGAGTCCGGATCAATGACTTGGAGGCCGCTTTTATTTATAATG

ATCCAACCTTAGAAGTTTGTCACAGTGAATCGAAACA GAGAAACCTCAATTATTTTTCCAATGCGTATGCAGCTGCAGTCAGTGCTGTGGACCCTGATG

CGGGGAATGGAGAACTCTGCATTAAGGTTCCCTCAGAGCTCTGGAAACATGTCGATG AGTTGAAGGTCCTGAAGATACATATTAATTTTTCTTTGGATC

AACCAAAAGGAGGTCTTCATTTTGTGGTACCCAGTGTAGAGGGGAGTATGGCAGAGAGAGGTGCTCATGTCTTCTCTTGCGGGTATCAAAATTCTACAAG

 ATTTTGGTTCCCGTGTGTCGATTCATACTCTGAGCTGTGTACCTGGAAGTTAGAATTTACAGTAGATGCTGCAATGGTAGCCGTGTCCAATGGAGATTT

GGTGGAGACCGTGTATACCCATGACATGAGGAAGAAGACCTTCCATTATATGCTTACTATTCCTACTGCAGCATCCAATATCTCCTTGGCCATTGGACCA

TTTGAAATACTCGTGGATCCATACATGCATGAG GTTACCCATTTTTGTTTGCCTCAACTTCTTCCGTTACTTAAACATACTACGTCATACATTCACGAA

GTTTTTGAATTTTATGAAGAAATTTTGACTTGTCGCTATCCGTACTCCTGTTTTAAGACGGTCTTCATTGATGAGGCATATGTTGAAGTGGCCGCTTACG

CTTCTATGAGCATTTTCAG CACAAACCTTCTGCACAGCGCCATGATTATAGACGAGACGCCGCTGACCAGACGGTGCTTGGCACAGGCTTTAGCACAGC

AGTTCTTCGGATGTTTCATATCCAGGATGTCTTG GTCTGATGAATGGGTGCTGAAGGGAATTTCAGGCTATATTTATGGACTGTGGATGAAAAAAACAT

TCGGAGTCAATGAGTACCACCATTGGATTAAAGAG - UNI1586 - GAGCTAGATAAAATAGTGGCGTATGAACTGAAAACTGGGGGAGTTTTGCTTC

ATCCCATATTTGGTGGTGGAAAAGAAAAGGATAA CCCCGCATCTCACCTCCACTTTTCCATAAAGCATCCACATACACTGTCCTGGGAGTACTACACTA

TGTTCCAGTGTAAAGCTCACCTCGTGATGAGACTGATTGAAAACAGAATCAGCATGGAATTTATGCTGCAA GTTTTCAATAAACTACTAAGTCTGGCCA

GCACTGCTTCGTCTCAGAAGTTCCAGTCACATATGTGGAGCCAGATGCTGGTTTCCACTTACGGGTTTTTGAAGTCCATTTCCAATGTCTCTGGCAAAGA

CATCCAGCCCCTAATAAAGCAGTGGGT AGACCAGAGTGGAGTGGTAAAGTTTTACGGAAGTTTTGCGTTTAATAGAAAACGAAATGTTTTAGAACTAGA

AATAAAGCAAGATTACACATCTCCTGGCACCCAGAAGTACGTG GGACCTCTTAAAGTGACAGTGCAAGAGTTAGATGGATCCTTCAACCATACCTTGCA

AATTGAAGAAAACAGCCTTAAACATGACATACCCTGCCACTCCAAGAGCAGAAG GAATAAGAAGAAAAAAATCCCACTGATGAATGGGGAAGAAGTTGA

TATGGATCTTTCTGCAATGGA TGCTGATTCCCCTTTGTTGTGGATAAGGATAGACCCAGATATGTCCGTCCTGAGGAAGGTGGAGTTTGAGCAGGCTGA

TTTTATGTGGCAGTATGAGCTCCGCTATGAGAGAGATGTTGTTGCTCAGCAGGAATCCATCTTGGCCTTGGAAAAATTCCCCACTCCGGCATCGCGCCTT

GCGCTCACTGATATACTAGAGCAAGAGCAGTGTTTCTACCGAGTCAGGATGTCAGCGTGCTTCTGTCTTGCAAAG ATTGCCAACTCAATGGTGAGCACG

TGGACAGGGCCGCCAGCCATGAAGTCTCTCTTTACTAGAATGTTCTGCTGTAAAACCTGCCCCAACATTGTGAAGACAAACAACTTCATGAGTTTCCAAA

GCTACTTTCTGCAGAAG ACTATGCCGGTTGCAATGGCTTTGTTAAGAGATGTACATAACCTTTGTCCTAAAGAAGTTTTAACATTTATTTTAGACTTAA

TCAAGTACAATGACAACAGAAAAAATAAG TTTTCAGATAACTATTATCGTGCAGAAATGATTGATGCCCTTGCTAACTCAGTTACACCTGCTGTCAGTG

TGAATAATGAAGTCAGAACTTTGGATAACTTAAATCCTGATGTGCGACTAATTCTTGAAGAAATAACCCGGTTTCTGAATATGGAAAAGCTTCTCCCAAG

TTACAGACACACCATCACTGTCAG TTGCTTGAGAGCCATCCGGGTGCTTCAGAAGAACGGGCACGTGCCGAGTGATGCATCTCTCTTCAAATCCTACGC

CGAGTATGGCCACTTTGTGGACATCAGGATAGCAGCTCTGGAAGCCGTCGTTGATTACACTAAAG TGGACAGGAGTTATGAAGAACTTCAGTGGCTACT

TAATATGATTCAGACTGACCCTGTTCCCTATGTGAG GCATAAGATTCTAAACATGCTGACTAAAAATCCACCATTTACAAAGAACATGGAATCTCCTTT

ATGCAACGAAGCCCTGGTAGATCAGCTCTGGAAGCTGATGAATTCTG GCACTGCACATGACTGGAGGTTACGGTGTGGTGCTGTGGACTTGTACTTCAC

GCTGTTTGGCCTCAGCAGACCGTCTTGCTTACCCTTGCCAGAGCTCGGGCTTGTTCTTAACCTAAAAGAGAAGAAAGCTGTCTTGAATCCTACCATTATT

CCAGAAGCTGGAGTAGGCAACCAGGAGTCTGCGAGTAACCCAGGCTGCCACGCTCAGCTAGCTGGATTCCAGAACCCT - UNI9089 - TTTTCAAGT

TCTCAGGATGAGGAGGAGGTTGACATGGATACTGTTCATGACAGTCAAGCCTTCATCTCCCATCATCTGAACATGCTCGAAAGGCCGTCCACTCCAG GG

CTCTCTAAGTACCGGCCGTCCGGCTCCAGATCCTCCTTAATGCCCCAGCATTCATTAGGCTGTGACATCACACCACCCACAAAACCCCAGTGGAGTATGG

AGCTGTCCCGAAAGGGAGCAG GTAAAGAGCAGCCTTTGGAGATGGGTGTGCATTCCATGGTGGCAGCCCCGCTCTCCATGTTTGCTAAGGAGGCTCTGT

CATCGCGACACAGCGAGCACCATCACCACCATCACCATGAGCACAAGAAGAAGAAGAAGAAGCACAAGCACAAACACAAGCACAAGCACAAGCACGACAG

CAAGGACAAGGACAGGGAGCCCTTCGCCTTCTCCAGCCCTGCCAGCGGCAGGTCTGTGCGCTCCCCCTCACTCTCAGACTGAAGCCTGGTCCTCTGTGGA

GACACAAGCAGGGAGTGTGGAGAGACTGCAGAGGATGTCTATTTGTATGCCTGAGGTTTATATAGGAATGAGTGTATTGGCTCTGGATGAATGTTCCCCC

CACCCCAGTCCCCCCCATTCTTCCTGAAAACAGAGGATGACTTTTATAAAAGCCTTCCTGTCCACTGCAGGCCCATTCAGATGCTGGTCTCCTGTGGACC

CACAAAGTCAGGTATGCTTGAAAGCCTTTGATGGATGTCAGAGGCAGAAGGACCTTTTCAACAGAAACAACTGCCAGATCTGTGGGACCCAGCGGTTCCA

TGAAGTGCTGAATACCGCCACTTGGAATTGCTGGAGAGGCTGTTGTGTAGGACTCAATCCCTCGACTGCTTTTTGTGTTAGCCATTGAAACTGAACACCG

TCATTTATGAGCAAAGAGTCTTATATTTCTTTTTACCCTAAAGTACAAAAAGTTTTGAAAGAAATTATTTTTTAAAAAATTTAAAGTAACTATCTTTTGG

TAGTACATTTGGTGATTATGATGTTGCAATGTAGCAGATGCAACATTATTCTCCAGTCAAGATGTTTAAATTATGTTTTGTTTTGTCTTCCATTAAGTGC

AAGTGAATGTGTTCATATGTAAAATATCTCTTGCTGAATGTGGACAGTTTACACACTTAACACATATTCTTTCTAAAATTACTCTGTACATAATAAGCCA

GGCATGGTTGTGCATGCCTGTAATTCCAGCAGTTGGGAAGTCGGAGGATCATTCAAGGCCAGCCCGAGATACATGAGAATCTGTGTCAAAAAAGCAAAGT

GACAAACGTTACTCTGTCTAACAAAACATGATACTCTGAAAGGGTGTCTTTATTTGCTGTTTGCGAGCTTGGATATAGATAATTTGGCCCACACTGGAGT

ATACCAGCAACAGTTTAAAATACATGTGCCATGCTTTGGTTTCGTATTTTAAAAGTTTGTATGGTTTTATGTTTTGGTTTTGATTTTAGGTTTTTGGTTT

TCTGAATTTACCAGGTTCTGTGTTAAAAAATATTTTCATATCTATTCAGTTTTATTATTTCTTTTGTTACTAAATATTTGACTCATTTCTTGATCTCAGA

ATAAATATTTCAAAGGGGATCCAAAAATGCTGGACTTTTAAATATACTTTTAGTTATATTTAACTTGTTTAATAAATAACTTTTTAAGTTGGACA
Translation
MPPTGLESSRMNRKKGDKGFESPRPYKL LTHQVVCINNINFQRKSVV - UNI26374 - GFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAF

IYNDPTLEVCHSESKQ QRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDE ELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC

GYQNSTR RFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHE VTHFCLPQLLPLL

KHTTSYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFS STNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSW WSDEWVLKGI

SGYIYGLWMKKTFGVNEYHHWIKE - UNI1586 - ELDKIVAYELKTGGVLLHPIFGGGKEKDN NPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMR

LIENRISMEFMLQ VFNKLLSLASTASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQPLIKQWV VDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSP

GTQKYV GPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRR RNKKKKIPLMNGEEVDMDLSAMD DADSPLLWIRIDPDMSVLRKVEFEQADFMWQ

YELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAK IANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMSFQSYFL

QK TMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNK FSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYR

HTITVS SCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYTKV VDRSYEELQWLLNMIQTDPVPYVR RHKILNMLTKNPPFTKNME

SPLCNEALVDQLWKLMNSG GTAHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAGVGNQESASNPGCHAQLAGFQNP - 

UNI9089 - FSSSQDEEEVDMDTVHDSQAFISHHLNMLERPSTPG GLSKYRPSGSRSSLMPQHSLGCDITPPTKPQWSMELSRKGAG GKEQPLEMGV

HSMVAAPLSMFAKEALSSRHSEHHHHHHHEHKKKKKKHKHKHKHKHKHDSKDKDREPFAFSSPASGRSVRSPSLSD

For any suggestions or comments, please send an email to unitrap@crg.es