Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037369 (Utx)
Chromosomal location
Chr X: 17739701 - 17857062 (+)
Description
ubiquitously transcribed tetratricopeptide repeat gene, X chromosome Gene [Source:MGI (curated);Acc:Utx-001]
RefSeq_dna
NM_009483 
RefSeq_peptide
NP_033509.1 
UniGene
Mm.471789 Mm.257498 
MGI
MGI:1095419 
Uniprot/SWISSPROT
O70546 
Uniprot/SPTREMBL
Q3TNW2 Q3TPN3 Q3TRP6 Q8R2W5 A2AL70 
Human Ortholog
ENSG00000147050 (UTX)
Omim not available
UniTrap UNI20489
Vector Insertion
Chr X: 17740574 - 17776283
Public Clones (sanger) E119F12 (ggtc) P136B08 (ggtc) IST14845F9 (tigm) IST14849F9 (tigm)
IST14475H9 (tigm) IST14786E4 (tigm)
Private Clones OST360766 (lexicon) OST291412 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8799
Vector Insertion
Chr X: 17776393 - 17785861
Public Clones RRA094 (baygenomics) TEA047 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17206
Vector Insertion
Chr X: 17785912 - 17794063
Public Clones not available
Private Clones OST447561 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI912
Vector Insertion
Chr X: 17794123 - 17799882
Public Clones BC0395 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044484
Sequence
GGCTGCGCCGAGCGGGCTGTGAGGGGGGGGTCACGGCAGCGGCGTGGGGTTCGCTGTGTGACACAATTACAACAACTTTGTGCTGGTGCCGGGGAAGTTT

GTGTCTCCTACGAATCCCCCCCAGAGCTCCCGCTCCTCGCGCGCTCCGGCCATTCCCGCCGACCCTGCCTGTGGCTGCCCCCTTCCCATCCCCGCGATGT

GACCCTACAGCCGAGCCGTCGCCGCTCCGGACCCAGTGGTTCCACAGCCTCTGCTGCCTCTGCCTTCACCTCTACCGCGTTAGGATTTTTCGCTGCCGCC

TCTCGCGGCAGAGGAGGAGGCAGAAATAAAGTTGGTGTGCCGGTCTTGTGCGGAGATTGGAGGCGTCCTTGCGGGCTCCGGCCCGGAGAGGGGGGGTGTC

GGCGTTGGAGTTGTGAATTCGCTGCGTTTCCATGAAATCCTGCGGAGTGTCGCTCGCTACCGCCGCCGCCGCCGCCGCCGCCGCCGCTTTCGGTGATGAG

GAAAAGAAAATGGCGGCGGGAAAAGCGAGCGGCGAGAGCGAGGAGGCGTCCCCCAGCCTGACAGCGGAGGAGAGGGAGGCGCTCGGCGGACTGGACAG C

CGCCTTTTCGGGTTCGTGAGGTTTCATGAAGATGGCGCCAGGATGAAGGCCCTGCTGGGCAAG - UNI20489 - GCTGTTCGCTGCTACGAATCTCT

AATCTTAAAAGCTGAAGGGAAAGTGGAGTCTGATTTCTTTTGTCAATTAGGTCACTTCAACCTCTTATTGGAAGATTATCCAAAAG - UNI8799 - C

ATTATCTGCATACCAGAGGTACTACAGTTTACAGTCTGATTACTGGAAG - UNI17206 - AATGCTGCCTTTTTATATGGTCTTGGTTTGGTCTACT

TCCATTACAATGCATTTCAGTG - UNI912 - GGCTATTAAAGCATTTCAGGAGGTGCTTTATGTCGATCCCAGCTTTTGTCGAGCCAAGGAAATTCA

TTTACGACTTGGGCTTATGTTCAAAGTGAACACAGACTATGAGTCTAGTTTAAAG CATTTTCAGTTAGCTTTGGTTGACTGTAATCCCTGCACTTTGTC

CAATGCTGAAA TTCAGTTTCACATTGCCCACTTATATGAAACCCAG AGGAAGTATCATTCTGCAAAAGAAGCTTATGAGCAACTTTTGCAGACAGAAA

ACCTTTCTGCACAAGTAAAAGCAACTATTTTACAACAATTAG GTTGGATGCATCACACTGTGGATCTCCTGGGAGATAAGGCCACCAAGGAAAGTTATG

CTATTCAGTATCTCCAGAAGTCCTTGGAAGCAGATCCAAATTCTGGCCAGTCCTGGTATTTCCTTGGAAG GTGCTATTCAAGTATTGGGAAAGTTCAGG

ATGCCTTTATATCTTACAGGCAATCTATTGATAAATCAGAAGCAAGTGCAGATACATGGTGTTCAATAGG TGTGCTCTATCAACAGCAAAATCAGCCTA

TGGATGCTTTGCAAGCTTATATTTGTGCTGTACAATTGGACCACGGTCATGCTGCAGCCTGGATGGATCTAGGCACTCTCTATGAATCCTGCAACCAACC

TCAGGATGCTATTAAATGCTATTTAAATGCAACTAGAAGCAAAAATTGTAGTAATACCTCTGGACTTGCAGCACGAATTAAGTATTTACAG GCTCAGTT

GTGTAACCTTCCACAAGGTAGTCTACAGAATAAAACTAAATTACTTCCTAGTATTGAGGAGGCATGGAGCCTACCAATCCCCGCAGAGCTTACCTCCAGG

CAGGGTGCCATGAACACAGCACAGCAG AATACTTCTGATAATTGGAGTGGTGGCAATGCACCACCTCCAGTAGAACAACAAACTCATTCATGGTGTTTG

ACACCACAGAAATTACAG CACTTGGAACAGCTCCGAGCAAACAGAAATAATTTAAATCCAGCACAGAAACTAATGCTGGAACAGCTGGAAAGTCAGTTT

GTCTTAATGCAGCAACACCAA ATGAGACAAACAGGAGTTGCACAGGTACGGCCTACTGGAATTCTTAATGGGCCAACAGTTGACTCATCACTGCCTACA

AACTCAGTTTCTGGCCAGCAGCCACAGCTTCCTCTGACCAGAATGCCTAGTGTCTCTCAGCCTGGAGTCCACACTGCCTGTCCTAGGCAGACTTTGGCCA

ATGGACCCTTTTCTGCAGGCCATGTTCCCTGTAGCACATCAAGAACACTGGGAAGTACAGACACTGTTTTGATAGGCAATAATCATGTAACAGGAAGTGG

AAGTAATGGAAACGTGCCTTACCTGCAGCGAAACGCACCCACTCTACCTCATAACCGCACAAACCTGACCAGCAGCACAGAGGAGCCGTGGAAAAACCAA

CTATCTAACTCCACTCAG GGGCTTCACAAAGGTCCGAGTTCACATTTGGCAGGTCCTAATGGTGAACGACCTCTATCTTCCACTGGGCCTTCCCAGCAT

CTCCAGGCAGCTGGCTCTGGTATTCAGAATCAGAATGGACATCCCACCCTGCCTAGCAATTCAGTAACACAGGGGGCTGCTCTCAATCACCTCTCCTCTC

ACACTGCTACCTCAGGTGGACAACAAGGCATTACCTTAACCAAAGAGAGCAAGCCTTCAGGAAACACATTGACGGTGCCTGAAACAAGCAGGCAAACTGG

AGAGACACCTAACAGCACTGCCAGTGTTGAGGGACTTCCTAATCATGTCCATCAGGTGATGGCAGATGCTGTTTGCAGTCCTAGCCATGGAGATTCTAAG

TCACCAGGTTTACTAAGTTCAGACAATCCTCAGCTCTCTGCCTTGTTGATGGGAAAAGCTAATAACAATGTGGGTCCTGGAACCTGTGACAAAGTCAATA

ACATCCACCCAACTGTCCATACAAAGACTGATAATTCTGTTGCCTCTTCACCATCTTCAGCCATTTCCACAGCAACACCTTCTCCTAAGTCCACTGAACA

GACAACCACAAACAGTGTTACCAGCCTTAACAGCCCTCACAGTGGGCTGCACACAATTAATGGAGAAGGAATGGAAGAATCTCAGAGCCCCATTAAAACA

GATCTGCTTCTAGTTAGCCACAGACCTAGTCCTCAGATCATACCATCAATGTCTGTGTCCATATATCCCAGCTCAGCAGAAGTTCTGAAAGCTTGCAG G

AATCTAGGTAAAAACGGCCTGTCTAATAGTAGCATTCTGTTGGATAAATGTCCGCCTCCAAGACCACCATCCTCACCATACCCTCCCTTGCCAAAGGACA

AGTTGAATCCACCTACACCTAGTATTTAT TTGGAAAATAAACGTGATGCTTTCTTTCCTCCATTACATCAATTTTGTACAAACCCAAACAACCCTGTTA

CAGTAATACGTGGCCTTGCTGGAGCTCTTAAATTAG ACTTGGGACTTTTCTCTACTAAAACTTTGGTGGAAGCTAACAATGAACATATGGTAGAAGTGA

GGACACAGTTGTTACAACCAGCAGATGAAAATTGGGACCCTACTGGAACCAAGAAAATCTGGCACTGTGAAAGTAATAGATCTCATACTACAATTGCTAA

ATATGCTCAGTACCAGGCCTCCTCATTCCAAGAATCATTGAGA GAAGAAAATGAGAAAAGAAGTCACCATAAAGACCACTCAGACAGTGAATCTACATC

ATCAGATAA TTCTGGGAAAAGAAGAAAAGGACCCTTTAAAACCATTAAGTTTGGGACCAACATTGACCTGTCTGATGACAAAAA GTGGAAGTTACAGC

TACATGAGCTGACTAAACTTCCTGCCTTCGTGAGAGTTGTATCTGCAGGAAATCTTTTAAGCCACGTTGGTCATACTATACTGGGCATGAACACAGTTCA

ACTATACATGAAAGTTCCAGGAAGCAGAACACCAG GTCATCAAGAAAATAACAACTTCTGTTCAGTTAATATAAATATTGGCCCAGGTGACTGTGAATG

GTTTGTTGTTCCTGAAGGCTACTGGGGTGTTTTGAATGACTTCTGTGAAAA AAATAATTTGAATTTCTTAATGGGTTCTTGGTGGCCCAACCTTGAAGA

TCTATATGAAGCAAATGTTCCAGTGTATAGGTTTATTCAGCGACCTGGAGATCTGGTCTGGATAAATGCTGGCACTGTTCATTGGGTTCAAGCTATTGGC

TGGTGCAACAATATTGCTTGGAATGTTGGTCCACTTACAG CCTGTCAGTATAAGTTAGCAGTGGAACGTTATGAATGGAACAAGTTGCAAAATGTAAAG

TCAATAGTACCCATGGTTCATCTTTCCTGGAATATGGCACGAAATATCAAGGTTTCAGATCCAAAGCTTTTTGAAATGATTAA GTATTGTCTTCTGAGA

ACGCTGAAGCAATGTCAGACATTGAGGGAAGCTCTAATTGCTGCAGGAAAAGAGATCATATGGCACGGGCGGACAAAAGAAGAACCAGCTCATTATTGTA

GTATTTGTGAG GTGGAGGTTTTTGATCTGCTTTTTGTCACTAATGAGAGTAATTCTCGAAAAACCTACATAGTACATTGCCAAGATTGTGCACGAAAAA

CAAGTGGGAATCTGGAAAATTTTGTGGTGCTAGAACAGTACAAAATGGAGGATCTGATGCAAGTCTATGACCAATTTACATTA GCTCCTCCATTACCAT

CCGCCTCATCTTGATATTGTTCCATGGACATTAAACATGAGACCTTTTCTGCTATTCAGAAAGTAACCCAGTTCTGCACCACTGCTATTTGTAGCTATCT

CGTAAGGCTGCTGGCTGAAAACTGTGTCTATGCAACCTTCCAAGTGTGGAGTGTCAACCAACTGGACGGGAGAGTACTGCTCCTATGCCAGGACTCTCGT

AAAGCTAATTAGCTGAACTTCAGAGAAAAAAAAAAGAATAATAATTACCACGTTTTGTATATATCTGACAAAACTGGCAACATCATAAAGACTACTGACT

TGAAGACAACCTCTTTTATATTTCTCGATTTCTGGGCTAATGAATTTGTTTTCACCTATCTTTTCCCTTTCAGAATTTTATTCGGGGGGGAAAATAACTA

GCCTAGCTGGTCATTTCTTTGTAAGGTAGTTAGCAATATTTAGTCTTTCTTTGGTCACCTTTTTTTTTTTAATGTGAAAAGTTAAGTAAGAAACTTTTTT

TACTGCTTTTATGAATTTCTGTCTTGTTTTGAAACTATGATCGTTATAATTTTGGTTCCCAAATAAAACATTTAAAAAAAATAATTAACAGCAACGTCAC

AAAGATAATGGATTGCACATAGACTAAGAAATAAACTTCAGAATTGTGATTTTTTTTGTTTCTAATCTTGATGTAAATTTACACTATTTATAAATACATA

TTTATTGCCTGAAAATATTTGTGAATGGAATGCTGTTATTTTTTCCAGATTTACCTGCCATTGAAATTTTAAGGAGTTCTGTAATTTCAAACACTACTCC

TATTACATTTTCTATGTGTAAATAAAACTGCTTAGCCTTGTACAGAAACTTTTATTAAAATTGTTTAATGTTTAAAGAGTTTTCTATTGTTTGAGTTTTA

AAAAGAATTTATGTACAGTGCCCAATTTTTGTTCACTTTTCAAATCTGATTATATATATTTTATATATACTTATGTCTGTATATATAATATATATAGAAA

TCTAGATATATGTATAAAGATTTAGAATTTGAATTTTTCTTGTTTTAAGTTTCACATCTATGGTAGATTTTTGAGGTGTCTACTGTAAAGTATTGCTCAC

AAAAAGTATGATTATTTTTAAAGAAATATATATGGTATGTATCTTCAAGACCTAAAATGTCAGACTGGTTTATTGTTAAATTGCAACTACTGCAATTACA

GACAAAAAAAATCTGCCAAATGTAGTATAATAGAAAACATAGTGATTGAACTTAAAACTTTAAAGGGAGTTTTAATACAGGCTTTTCAAATCCTA
Translation
MKSCGVSLATAAAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDS SRLFGFVRFHEDGARMKALLGK - UNI20489 - AVRCYES

LILKAEGKVESDFFCQLGHFNLLLEDYPKA - UNI8799 - ALSAYQRYYSLQSDYWK - UNI17206 - NAAFLYGLGLVYFHYNAFQW - UNI

912 - WAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLK HFQLALVDCNPCTLSNAEI IQFHIAHLYETQ RKYHSAKEAYEQLLQTENL

SAQVKATILQQLG GWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGR RCYSSIGKVQDAFISYRQSIDKSEASADTWCSIG GVLYQQQ

NQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCSNTSGLAARIKYLQ AQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAE

LTSRQGAMNTAQQ NTSDNWSGGNAPPPVEQQTHSWCLTPQKLQ HLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQ MRQTGVAQVRPTGILNGPTV

DSSLPTNSVSGQQPQLPLTRMPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTE

EPWKNQLSNSTQ GLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNTLTVP

ETSRQTGETPNSTASVEGLPNHVHQVMADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGPGTCDKVNNIHPTVHTKTDNSVASSPSSAISTATP

SPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPIKTDLLLVSHRPSPQIIPSMSVSIYPSSAEVLKACR RNLGKNGLSNSSILLDKCPPPRPPSS

PYPPLPKDKLNPPTPSIY LENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLD DLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHC

ESNRSHTTIAKYAQYQASSFQESLR EENEKRSHHKDHSDSESTSSDN NSGKRRKGPFKTIKFGTNIDLSDDKK KWKLQLHELTKLPAFVRVVSAGNL

LSHVGHTILGMNTVQLYMKVPGSRTPG GHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEK KNNLNFLMGSWWPNLEDLYEANVPVYRFIQRP

GDLVWINAGTVHWVQAIGWCNNIAWNVGPLTA ACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIK KYCLLRTLKQCQTLREAL

IAAGKEIIWHGRTKEEPAHYCSICE VEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTL APPLPSASS
Transcript ENSMUST00000052368
Sequence
GGAAGTTTGTGTCTCCTACGAATCCCCCCCAGAGCTCCCGCTCCTCGCGCGCTCCGGCCATTCCCGCCGACCCTGCCTGTGGCTGCCCCCTTCCCATCCC

CGCGATGTGACCCTACAGCCGAGCCGTCGCCGCTCCGGACCCAGTGGTTCCACAGCCTCTGCTGCCTCTGCCTTCACCTCTACCGCGTTAGGATTTTTCG

CTGCCGCCTCTCGCGGCAGAGGAGGAGGCAGAAATAAAGTTGGTGTGCCGGTCTTGTGCGGAGATTGGAGGCGTCCTTGCGGGCTCCGGCCCGGAGAGGG

GGGGTGTCGGCGTTGGAGTTGTGAATTCGCTGCGTTTCCATGAAATCCTGCGGAGTGTCGCTCGCTACCGCCGCCGCCGCCGCCGCCGCCGCCGCTTTCG

GTGATGAGGAAAAGAAAATGGCGGCGGGAAAAGCGAGCGGCGAGAGCGAGGAGGCGTCCCCCAGCCTGACAGCGGAGGAGAGGGAGGCGCTCGGCGGACT

GGACAG CCGCCTTTTCGGGTTCGTGAGGTTTCATGAAGATGGCGCCAGGATGAAGGCCCTGCTGGGCAAG - UNI20489 - GCTGTTCGCTGCTAC

GAATCTCTAATCTTAAAAGCTGAAGGGAAAGTGGAGTCTGATTTCTTTTGTCAATTAGGTCACTTCAACCTCTTATTGGAAGATTATCCAAAAG - UNI

8799 - CATTATCTGCATACCAGAGGTACTACAGTTTACAGTCTGATTACTGGAAG - UNI17206 - AATGCTGCCTTTTTATATGGTCTTGGTTT

GGTCTACTTCCATTACAATGCATTTCAGTG - UNI912 - GGCTATTAAAGCATTTCAGGAGGTGCTTTATGTCGATCCCAGCTTTTGTCGAGCCAAG

GAAATTCATTTACGACTTGGGCTTATGTTCAAAGTGAACACAGACTATGAGTCTAGTTTAAAG CATTTTCAGTTAGCTTTGGTTGACTGTAATCCCTGC

ACTTTGTCCAATGCTGAAA TTCAGTTTCACATTGCCCACTTATATGAAACCCAG AGGAAGTATCATTCTGCAAAAGAAGCTTATGAGCAACTTTTGCA

GACAGAAAACCTTTCTGCACAAGTAAAAGCAACTATTTTACAACAATTAG GTTGGATGCATCACACTGTGGATCTCCTGGGAGATAAGGCCACCAAGGA

AAGTTATGCTATTCAGTATCTCCAGAAGTCCTTGGAAGCAGATCCAAATTCTGGCCAGTCCTGGTATTTCCTTGGAAG GTGCTATTCAAGTATTGGGAA

AGTTCAGGATGCCTTTATATCTTACAGGCAATCTATTGATAAATCAGAAGCAAGTGCAGATACATGGTGTTCAATAGG TGTGCTCTATCAACAGCAAAA

TCAGCCTATGGATGCTTTGCAAGCTTATATTTGTGCTGTACAATTGGACCACGGTCATGCTGCAGCCTGGATGGATCTAGGCACTCTCTATGAATCCTGC

AACCAACCTCAGGATGCTATTAAATGCTATTTAAATGCAACTAGAAGCAAAAATTGTAGTAATACCTCTGGACTTGCAGCACGAATTAAGTATTTACAG 

GCTCAGTTGTGTAACCTTCCACAAGGTAGTCTACAGAATAAAACTAAATTACTTCCTAGTATTGAGGAGGCATGGAGCCTACCAATCCCCGCAGAGCTTA

CCTCCAGGCAGGGTGCCATGAACACAGCACAGCAG AATACTTCTGATAATTGGAGTGGTGGCAATGCACCACCTCCAGTAGAACAACAAACTCATTCAT

GGTGTTTGACACCACAGAAATTACAG CACTTGGAACAGCTCCGAGCAAACAGAAATAATTTAAATCCAGCACAGAAACTAATGCTGGAACAGCTGGAAA

GTCAGTTTGTCTTAATGCAGCAACACCAA ATGAGACAAACAGGAGTTGCACAGGTACGGCCTACTGGAATTCTTAATGGGCCAACAGTTGACTCATCAC

TGCCTACAAACTCAGTTTCTGGCCAGCAGCCACAGCTTCCTCTGACCAGAATGCCTAGTGTCTCTCAGCCTGGAGTCCACACTGCCTGTCCTAGGCAGAC

TTTGGCCAATGGACCCTTTTCTGCAGGCCATGTTCCCTGTAGCACATCAAGAACACTGGGAAGTACAGACACTGTTTTGATAGGCAATAATCATGTAACA

GGAAGTGGAAGTAATGGAAACGTGCCTTACCTGCAGCGAAACGCACCCACTCTACCTCATAACCGCACAAACCTGACCAGCAGCACAGAGGAGCCGTGGA

AAAACCAACTATCTAACTCCACTCAG GGGCTTCACAAAGGTCCGAGTTCACATTTGGCAGGTCCTAATGGTGAACGACCTCTATCTTCCACTGGGCCTT

CCCAGCATCTCCAGGCAGCTGGCTCTGGTATTCAGAATCAGAATGGACATCCCACCCTGCCTAGCAATTCAGTAACACAGGGGGCTGCTCTCAATCACCT

CTCCTCTCACACTGCTACCTCAGGTGGACAACAAGGCATTACCTTAACCAAAGAGAGCAAGCCTTCAGGAAACACATTGACGGTGCCTGAAACAAGCAGG

CAAACTGGAGAGACACCTAACAGCACTGCCAGTGTTGAGGGACTTCCTAATCATGTCCATCAGGTGATGGCAGATGCTGTTTGCAGTCCTAGCCATGGAG

ATTCTAAGTCACCAGGTTTACTAAGTTCAGACAATCCTCAGCTCTCTGCCTTGTTGATGGGAAAAGCTAATAACAATGTGGGTCCTGGAACCTGTGACAA

AGTCAATAACATCCACCCAACTGTCCATACAAAGACTGATAATTCTGTTGCCTCTTCACCATCTTCAGCCATTTCCACAGCAACACCTTCTCCTAAGTCC

ACTGAACAGACAACCACAAACAGTGTTACCAGCCTTAACAGCCCTCACAGTGGGCTGCACACAATTAATGGAGAAGGAATGGAAGAATCTCAGAGCCCCA

TTAAAACAGATCTGCTTCTAGTTAGCCACAGACCTAGTCCTCAGATCATACCATCAATGTCTGTGTCCATATATCCCAGCTCAGCAGAAGTTCTGAAAGC

TTGCAG GAATCTAGGTAAAAACGGCCTGTCTAATAGTAGCATTCTGTTGGATAAATGTCCGCCTCCAAGACCACCATCCTCACCATACCCTCCCTTGCC

AAAGGACAAGTTGAATCCACCTACACCTAGTATTTAT TTGGAAAATAAACGTGATGCTTTCTTTCCTCCATTACATCAATTTTGTACAAACCCAAACAA

CCCTGTTACAGTAATACGTGGCCTTGCTGGAGCTCTTAAATTAG ACTTGGGACTTTTCTCTACTAAAACTTTGGTGGAAGCTAACAATGAACATATGGT

AGAAGTGAGGACACAGTTGTTACAACCAGCAGATGAAAATTGGGACCCTACTGGAACCAAGAAAATCTGGCACTGTGAAAGTAATAGATCTCATACTACA

ATTGCTAAATATGCTCAGTACCAGGCCTCCTCATTCCAAGAATCATTGAGA GAAGAAAATGAGAAAAGAAGTCACCATAAAGACCACTCAGACAGTGAA

TCTACATCATCAGATAA TTCTGGGAAAAGAAGAAAAGGACCCTTTAAAACCATTAAGTTTGGGACCAACATTGACCTGTCTGATGACAAAAA GTGGAA

GTTACAGCTACATGAGCTGACTAAACTTCCTGCCTTCGTGAGAGTTGTATCTGCAGGAAATCTTTTAAGCCACGTTGGTCATACTATACTGGGCATGAAC

ACAGTTCAACTATACATGAAAGTTCCAGGAAGCAGAACACCAG GTCATCAAGAAAATAACAACTTCTGTTCAGTTAATATAAATATTGGCCCAGGTGAC

TGTGAATGGTTTGTTGTTCCTGAAGGCTACTGGGGTGTTTTGAATGACTTCTGTGAAAA AAATAATTTGAATTTCTTAATGGGTTCTTGGTGGCCCAAC

CTTGAAGATCTATATGAAGCAAATGTTCCAGTGTATAGGTTTATTCAGCGACCTGGAGATCTGGTCTGGATAAATGCTGGCACTGTTCATTGGGTTCAAG

CTATTGGCTGGTGCAACAATATTGCTTGGAATGTTGGTCCACTTACAG CCTGTCAGTATAAGTTAGCAGTGGAACGTTATGAATGGAACAAGTTGCAAA

ATGTAAAGTCAATAGTACCCATGGTTCATCTTTCCTGGAATATGGCACGAAATATCAAGGTTTCAGATCCAAAGCTTTTTGAAATGATTAA GTATTGTC

TTCTGAGAACGCTGAAGCAATGTCAGACATTGAGGGAAGCTCTAATTGCTGCAGGAAAAGAGATCATATGGCACGGGCGGACAAAAGAAGAACCAGCTCA

TTATTGTAGTATTTGTGAG GTGGAGGTTTTTGATCTGCTTTTTGTCACTAATGAGAGTAATTCTCGAAAAACCTACATAGTACATTGCCAAGATTGTGC

ACGAAAAACAAGTGGGAATCTGGAAAATTTTGTGGTGCTAGAACAGTACAAAATGGAGGATCTGATGCAAGTCTATGACCAATTTACATTAGTAAGTGAA

ATCAACAT GCTCCTCCATTACCATCCGCCTCATCTTGATATTGTTCCATGGACATTAAACATGAGACCTTTTCTGCTATTCAGAAAGTAACCCAGTTCT

GCACCACTGCTATTTGTAGCTATCTCGTAAGGCTGCTGGCTGAAAACTGTGTCTATGCAACCTTCCAAGTGTGGAGTGTCAACCAACTGGACGGGAGAGT

ACTGCTCCTATGCCAGGACTCTCGTAAAGCTAATTAGCTGAACTTCAGAGAAAAAAAAAAGAATAATAATTACCACGTTTTGTATATATCTGACAAAACT

GGCAACATCATAAAGACTACTGACTTGAAGACAACCTCTTTTATATTTCTCGATTTCTGGGCTAATGAATTTGTTTTCACCTATCTTTTCCCTTTCAGAA

TTTTATTCGGGGGGGAAAATAACTAGCCTAGCTGGTCATTTCTTTGTAAGGTAGTTAGCAATATTTAGTCTTTCTTTGGTCACCTTTTTTTTTTTAATGT

GAAAAGTTAAGTAAGAAACTTTTTTTACTGCTTTTATGAATTTCTGTCTTGTTTTGAAACTATGATCGTTATAATTTTGGTTCCCAAATAAAACATTTAA

AAAAAATAATTAACAGCAACGTCACAAAGATAATGGATTGCACATAGACTAAGAAATAAACTTCAGAATTGTGATTTTTTTTGTTTCTAATCTTGATGTA

AATTTACACTATTTATAAATACATATTTATTGCCTG
Translation
MKSCGVSLATAAAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDS SRLFGFVRFHEDGARMKALLGK - UNI20489 - AVRCYES

LILKAEGKVESDFFCQLGHFNLLLEDYPKA - UNI8799 - ALSAYQRYYSLQSDYWK - UNI17206 - NAAFLYGLGLVYFHYNAFQW - UNI

912 - WAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLK HFQLALVDCNPCTLSNAEI IQFHIAHLYETQ RKYHSAKEAYEQLLQTENL

SAQVKATILQQLG GWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGR RCYSSIGKVQDAFISYRQSIDKSEASADTWCSIG GVLYQQQ

NQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCSNTSGLAARIKYLQ AQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAE

LTSRQGAMNTAQQ NTSDNWSGGNAPPPVEQQTHSWCLTPQKLQ HLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQ MRQTGVAQVRPTGILNGPTV

DSSLPTNSVSGQQPQLPLTRMPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTE

EPWKNQLSNSTQ GLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNTLTVP

ETSRQTGETPNSTASVEGLPNHVHQVMADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGPGTCDKVNNIHPTVHTKTDNSVASSPSSAISTATP

SPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPIKTDLLLVSHRPSPQIIPSMSVSIYPSSAEVLKACR RNLGKNGLSNSSILLDKCPPPRPPSS

PYPPLPKDKLNPPTPSIY LENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLD DLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHC

ESNRSHTTIAKYAQYQASSFQESLR EENEKRSHHKDHSDSESTSSDN NSGKRRKGPFKTIKFGTNIDLSDDKK KWKLQLHELTKLPAFVRVVSAGNL

LSHVGHTILGMNTVQLYMKVPGSRTPG GHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEK KNNLNFLMGSWWPNLEDLYEANVPVYRFIQRP

GDLVWINAGTVHWVQAIGWCNNIAWNVGPLTA ACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIK KYCLLRTLKQCQTLREAL

IAAGKEIIWHGRTKEEPAHYCSICE VEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLVSEINM MLLHYHPPHL

DIVPWTLNMRPFLLFRK

For any suggestions or comments, please send an email to unitrap@crg.es