Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037373 (Ctbp1)
Chromosomal location
Chr 5: 33590403 - 33617610 (-)
Description
C-terminal binding protein 1 Gene [Source:MGI Symbol;Acc:MGI:1201685]
RefSeq_dna
NM_013502 
RefSeq_peptide
NP_038530.1 
UniGene
Mm.472242 
MGI
MGI:1201685 
Uniprot/SWISSPROT
O88712 
Human Ortholog
ENSG00000159692 (CTBP1)
Omim not available
UniTrap UNI1350
Vector Insertion
Chr 5: 33609687 - 33617427
Public Clones CJ0571 (sanger) IST14632A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10016
Vector Insertion
Chr 5: 33593722 - 33601786
Public Clones XE153 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079746
Sequence
CGCGGTGGCGGCTCGGCACGGCGGTGGCCGGGCGCAGGCGGCCGGGCGGAGTAGCAGACTGCGCCGAAGCCGCCCCAGGCGCAGGGCTCGCGGCGGCGGA

GAGCGCCGGACTCATCGGGGCCCGCGGCCACCCGCACCTTTCAATGGGCAGCTCCCACTTGCTCAACAAGGGCCTGCCGCTGG - UNI1350 - GCGT

CCGACCTCCCATCATGAACGGGCCCATGCACCCCCGGCCCCTGGTGGCGCTGCTGGATGGCCGGGACTGCACAGTGGAGATGCCTATCCTGAAGGATGTG

GCCACAGTAGCCTTCTGTGATGCACAGTCCACACAGGAGATCCATGAGAAG GTACTGAATGAGGCTGTGGGTGCCCTGATGTACCATACCATCACACTG

ACCAGAGAAGATCTGGAGAAGTTTAAAGCTCTTAGAATCATCGTCCGAATTGGCAGCGGGTTTGACAATATCGACATCAAGTCAGCTGGGGATCTAG GC

ATCGCAGTGTGCAATGTGCCGGCAGCATCTGTGGAAGAAACGGCAGACTCCACCCTGTGCCACATCCTGAACCTGTACCGACGAACCACCTGGCTACACC

AGGCCCTTCGGGAAGGCACTCGAGTCCAGAGTGTAGAGCAGATCCGAGAGGTGGCTTCAGGAGCTGCCAGGATCCGTGGAGAGACCTTGGGCATCATTGG

ACTAG - UNI10016 - GTCGTGTGGGCCAGGCGGTGGCACTTCGGGCAAAGGCTTTTGGCTTCAACGTCCTCTTCTATGATCCATACCTATCTGATG

GAATCGAGCGGGCCCTGGGGCTACAGCGCGTGAGCACGCTGCAGGACCTGCTCTTCCACAGTGACTGCGTTACCCTGCATTGCGGCCTCAATGAGCACAA

CCACCACCTCATCAATGACTTTACTGTCAAGCAG ATGAGACAAGGAGCCTTTCTGGTGAACACAGCCCGTGGTGGCCTGGTGGATGAGAAGGCACTGGC

CCAGGCCCTGAAGGAAGGGCGGATCCGTGGCGCAGCGCTGGACGTGCATGAGTCAGAGCCCTTCAG CTTTAGCCAGGGACCCTTAAAGGATGCACCCAA

CCTCATCTGCACACCCCATGCTGCATGGTACAGTGAGCAGGCGTCCATTGAGATGAGAGAGGAGGCAGCCCGGGAAATCCGGCGAGCCATCACAG GCCG

GATCCCAGATAGCTTGAAAAACTGTGTCAACAAGGACCACCTGACAGCCGCCACGCACTGGGCCAGCATGGACCCTGCTGTGGTGCACCCTGAGCTCAAT

GGGGCTGCCTACAG CAGGTACCCTCCAGGCGTCGTGAGTGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGGATTGTTCCCAGTGCCATGTCCCTG

TCTCATGGCCTGCCCCCTGTGGCCCACCCACCCCACGCTCCCTCTCCTGGCCAGACTGTCAAGCCTGAGGCGGATAGAGACCATACGAGTGACCAGTTGT

AGCCTGTGAGGAGCTGTCCAGCCTTGGCACCTGGTGGAGGGTGCTGCACGCTCTTGGACCCAAGTGTGCAGAGGTGGCATCCAGTGTGGGCCCTAGCACT

CCAGAGACTGGCCCGGGCGTGCACTAGGCGGGGCAAGAGGAAGCACGTCCCCAAGTTGATTGTAGTTGTCCCGTCCTGTGGGCTGGCTCACTGTCCTGTG

TCCTTTGCGTTCCTCGTTTAAGCAAAAGAAGTTAGTAGCTAATTCTATCACGAATGTTCTTGTCTGTGTACAGTTTTTAGAACATTACAAAGGATTTGTT

TGCTTAGCTGTCAACAAAAAGAAAACCTGAGGGAGCATTCAGCAAGTCAGTTTGAGATTATTTTTCCTTTTCTACGTTGGAACGTGCCCCGGAATGTGGC

CGTCGGCACACTTCTCAGGACAATGAATCCTTCCTGTTTTTCTTTTTATGCCACACAGTGCATTGTTTTTCTACCTGCTTGTCTTATTTTTAGAATAATT

TAGAAAAACAACAAAGGCTGTTTTTCCTAATTTTGGCATGAACCCCTTGTTCCAAGTGAAGGCGGCATCACGAGTGGCTCCGAGGCGTCTGCAGTGCCCA

GGGTGCTCAGGACCACCGGGGTCTGTCCTGGGGGAGGCAGGGGTTGGCAGACCCTTGCCTGCGTGGTGCCGTCCTGCTCATGTGGTAGGCTAGCAATATT

TTGGTTAAAATCATGTTTGTGACTGTAACCATTTGTATGAATTATTTT
Translation
MGSSHLLNKGLPLG - UNI1350 - GVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEK VLNEAVGALMYHTITLTRED

LEKFKALRIIVRIGSGFDNIDIKSAGDLG GIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLG

 - UNI10016 - GRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQ MRQGAFLVNTARG

GLVDEKALAQALKEGRIRGAALDVHESEPFS SFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITG GRIPDSLKNCVNKDHLTAATHWA

SMDPAVVHPELNGAAYS SRYPPGVVSVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHTSDQL

For any suggestions or comments, please send an email to unitrap@crg.es