Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037400 (Atp11b)
Chromosomal location
Chr 3: 35653056 - 35755193 (+)
Description
ATPase, class VI, type 11B Gene [Source:MGI (curated);Acc:Atp11b-001]
RefSeq_dna
NM_029570 
RefSeq_peptide
NP_083846.2 
UniGene
Mm.239416 Mm.401495 
MGI
MGI:1923545 
Uniprot/SPTREMBL
Q8VH36 Q3U2B7 Q6DFW5 Q6ZQ17 Q78I20 Q8R0F1 
Human Ortholog
ENSG00000058063 (ATP11B)
Omim not available
UniTrap UNI12465
Vector Insertion
Chr 3: 35653333 - 35676051
Public Clones F009E08 (ggtc) (ggtc) IST14553H1 (tigm) IST10102F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21535
Vector Insertion
Chr 3: 35676619 - 35676946
Public Clones not available
Private Clones OST326626 (lexicon) OST251382 (lexicon) OST186132 (lexicon) OST46191 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37186
Vector Insertion
Chr 3: 35683510 - 35687008
Public Clones CMHD-GT_506F4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18356
Vector Insertion
Chr 3: 35688584 - 35694680
Public Clones not available
Private Clones OST425001 (lexicon) OST60358 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35745
Vector Insertion
Chr 3: 35705888 - 35708278
Public Clones IST12963C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108185
Sequence
TGGAGAG GTATAAGAGAG GAGAAA - UNI21535 - GGTTTTGACCCACCACATCAAAGTGACACAAGAACTATTTACATAGCCAACAGGTTTCCT

CAGAATGGCCTTTACACACCTCAGAAATTTATAGATAACCGGATCATTTCATCTAAG TATACTATATGGAATTTTGTTCCAAAAAATTTATTTGAACAG

TTCAGAAGAGTGGCAAACTTTTATTTTCTTATTATATTTTTGGTTCAG CTTATGATTGATACACCTACCAGTCCAATTACCAGTGGACTTCCATTATTC

TTTGTGATAACAGTAACTGCCATAAAACAG - UNI37186 - GGTTATGAAGACTGGTTACGCCATAACTCAGATAATGAAGTAAACGGAGCTCCTGT

CTATGTTGTCAGAAGTGGGGGGCTTGTAAAAACTCGATCCAAAAACATTCGG GTGGGTGATATTGTTCGTATAGCCAAAGATGAAATTTTTCCTGCAGA

TTTGGTGCTTCTGTCCTCAGATCGACTTGATGGTTCATGTCATGTGACAACTGCTAGTTTGGATGGAGAGACAAACCTAAAG ACACATGTGTCAGTTCC

AGAAACAGCAGTATTACAAACAGTTGCCAACTTGGACAGTCTCATAGCTGTAATAGAATGCCAACAGCCAGAAGCAGATTTATACAG - UNI18356 -

 ATTTATGGGACGAATGATAATAACTCAACAAATGGAAGAAATTGTAAG ACCTCTGGGACCAGAGAGTCTCTTGCTTCGTGGAGCCAGATTAAAAAATA

CAAAAGAAATTTTTG GTGTGGCTGTATACACTGGAATGGAAACTAAGATGGCACTAAATTACAAGAGCAAGTCACAGAAAAGATCTGCAGTAGAAAA A

TCAATGAACACATTTTTAATAATTTACCTAATAATACTTATTTCTGAGGCCATCATCAGTACGATCTTGAAATATACCTGGCAAGCTGAAGAAAAATGGG

ATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGAAACAGTAGTAAG ATTCTGAGATTTATTTCTGACTTCCTTGCTTTTTTGGTACTCTACAATT

TCATCATTCCAATTTCTCTGTATGTGACAGTTGAGATGCAGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCACGAAGAGTCAGA

TCAGAAAGCTCAAGTCAATACTTCTGATCTGAATGAAGAGCTTGGGCAG - UNI35745 - GTGGAATATGTATTTACAGATAAAACTGGAACACTGA

CAGAAAATGAGATGCAGTTTCGAGAATGTTCAATTAATGGCCTGAAATACCAAGAAATCAATGGTAAACTTGTACCTGAAGGACCAAGCCCAGACTCCAC

AGAAGGAGAAGTGCCTTTCCTTGGTAGTTTATCCCATCTCAGCAACTCAGCCCATCTCACAGCCACTTCTCTTAGAACCAGTCCTGAAAGTGAAACTGAG

CTA ATCAAAGAACACGATCTGTTCTTTAAAGCAGTCAGTCTTTGCCATACTGTACAGATCAGCAATGTTCAAACTGACGGCATCGGGGATGGTCCCTGG

CAGCCCAACCTGGCACCTGCACAGCTGGAGTACTATGCATCTTCACCAGATGAAAAGGCTCTGGTGGAAGCTGCGGCAAG AGCTGGTATTATATTTGTA

GGCATTTCTGAAGAAACTATGGAGGTTAAAGTACTTGGGAGATTGGAAAG GTACAAATTGCTTCATATTCTGGAATTTGATTCAGATCGTAGGAGAATG

AGTGTAATTGTTCAGGCACCTTCAG GTGAGAAGCTTTTATTTGCTAAAGGAGCAGAATCTTCAATTCTCCCTAAATGTATAGGTGGAGAAATAGCAAAA

ACCAGAATTCATGTTGATGAGTTTGCTTTG AAAGGACTGCGGACACTGTGTATAGCTTACAGACAGTTTACAGCTAAAGAGTATGAAGATGTAGACAGG

CGCCTGTTTGAGGCCAGAACTGCCTTGCAGCATCGGGAAGAGAAATTGGCTGATGCCTTCCAGTACATTGAGAAAGACCTGATATTGCTAGGAGCTACAG

CAGTGGAAGACAG ACTACAAGATAAAGTTCGAGAAACTATTGAAGCACTGAGAATGGCTGGTATTAAAGTATGGGTACTTACTGGAGACAAACATGAAA

CAGCTGTTAGTGTGAGTTTATCTTGTGGACATTTTCATAGAACTATGAATATCCTGGAACTTATCAACCAGAAGTCAGATAGTGGATGTGCTGAACAGTT

GAGGCAGCTTGCCAGAAG AATTACAGAGGACCATGTGATTCAGCATGGGCTAGTAGTAGATGGGACCAGCTTATCTCTTGCACTCAGGGAACATGAAAA

GCTCTTTATGGAAGTTTGCAGAAACTGTTCAGCTGTATTATGTTGTCGCATGGCACCTTTACAGAAAGCAAAA GTAATAAGACTGATAAAAATCTCTCC

TGAGAAACCGATAACACTGGCTGTTGGTGATGGTGCTAATGATGTAAGCATGATACAAGAAGCGCATGTTGGCATAG AATTCTTTCATTGGACTTAGTG

GATTATTGCTATTGGCAGTGGTTCAGCAATGAGTGATTTAGTATTTCATCTACTCTGATCTGTCACTGTTATGGAAGTGTGAGGACCATGTGTAGCTCCT

CTGAGGGATAAAGTTCTAGCTTAGAGGAGTCAGCCTTGTCCAGGAAGCGTCTTCATGGTGTGTATGATGGCTAGACTTGAGGCTGGATCGTTGTATGTCT

TAAAATCAACCCCTCCTCTTTGGGATAATAAATATTAATTTTGAAACTTC
Translation
WRG GIRE EK - UNI21535 - GFDPPHQSDTRTIYIANRFPQNGLYTPQKFIDNRIISSK YTIWNFVPKNLFEQFRRVANFYFLIIFLVQ LMID

TPTSPITSGLPLFFVITVTAIKQ - UNI37186 - GYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNIR VGDIVRIAKDEIFPADLVLLSSDRLD

GSCHVTTASLDGETNLK THVSVPETAVLQTVANLDSLIAVIECQQPEADLYR - UNI18356 - RFMGRMIITQQMEEIVR RPLGPESLLLRGARL

KNTKEIFG GVAVYTGMETKMALNYKSKSQKRSAVEK KSMNTFLIIYLIILISEAIISTILKYTWQAEEKWDEPWYNQKTEHQRNSSK ILRFISDFLA

FLVLYNFIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQ - UNI35745 - VEYVFTDKTGTLTENEMQFRECSINGLKYQ

EINGKLVPEGPSPDSTEGEVPFLGSLSHLSNSAHLTATSLRTSPESETEL IKEHDLFFKAVSLCHTVQISNVQTDGIGDGPWQPNLAPAQLEYYASSPD

EKALVEAAAR RAGIIFVGISEETMEVKVLGRLER RYKLLHILEFDSDRRRMSVIVQAPSG GEKLLFAKGAESSILPKCIGGEIAKTRIHVDEFAL K

GLRTLCIAYRQFTAKEYEDVDRRLFEARTALQHREEKLADAFQYIEKDLILLGATAVEDR RLQDKVRETIEALRMAGIKVWVLTGDKHETAVSVSLSCG

HFHRTMNILELINQKSDSGCAEQLRQLARR RITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRNCSAVLCCRMAPLQKAK VIRLIKISPEKPITLA

VGDGANDVSMIQEAHVGIE EFFHWT
Transcript ENSMUST00000108186
Sequence
GAAGGTGGCGGCGGCTCAGCGGGGAGTAGTGCTGCGCCGGGCGCGGTTGGCAGCCAGGCCGCGCCTGTAGGACCTCCGGGCCGGGGTGGCGGGATGGGGA

CCCGACTCGGGTAGAAAAGCGGGGACAGCAGAGAGCAGAACTTAAGCCCGAGGGGCTCGCCTGCTCCGGTCACACTCGGAGTCCTCTTCCACCTGCTGCC

GCTCGGTCCCGCGTCCGGCGGGCCACGACGGCGTCGGCGACGGCGGGGGCATGTGGCGCTGGGTCCGGCAGCAGCTG - UNI12465 - - UNI2153

5 - GGTTTTGACCCACCACATCAAAGTGACACAAGAACTATTTACATAGCCAACAGGTTTCCTCAGAATGGCCTTTACACACCTCAGAAATTTATAGAT

AACCGGATCATTTCATCTAAG TATACTATATGGAATTTTGTTCCAAAAAATTTATTTGAACAGTTCAGAAGAGTGGCAAACTTTTATTTTCTTATTATA

TTTTTGGTTCAG CTTATGATTGATACACCTACCAGTCCAATTACCAGTGGACTTCCATTATTCTTTGTGATAACAGTAACTGCCATAAAACAG - UNI

37186 - GGTTATGAAGACTGGTTACGCCATAACTCAGATAATGAAGTAAACGGAGCTCCTGTCTATGTTGTCAGAAGTGGGGGGCTTGTAAAAACTCG

ATCCAAAAACATTCGG GTGGGTGATATTGTTCGTATAGCCAAAGATGAAATTTTTCCTGCAGATTTGGTGCTTCTGTCCTCAGATCGACTTGATGGTTC

ATGTCATGTGACAACTGCTAGTTTGGATGGAGAGACAAACCTAAAG ACACATGTGTCAGTTCCAGAAACAGCAGTATTACAAACAGTTGCCAACTTGGA

CAGTCTCATAGCTGTAATAGAATGCCAACAGCCAGAAGCAGATTTATACAG - UNI18356 - ATTTATGGGACGAATGATAATAACTCAACAAATGG

AAGAAATTGTAAG ACCTCTGGGACCAGAGAGTCTCTTGCTTCGTGGAGCCAGATTAAAAAATACAAAAGAAATTTTTG GTGTGGCTGTATACACTGGA

ATGGAAACTAAGATGGCACTAAATTACAAGAGCAAGTCACAGAAAAGATCTGCAGTAGAAAA ATCAATGAACACATTTTTAATAATTTACCTAATAATA

CTTATTTCTGAGGCCATCATCAGTACGATCTTGAAATATACCTGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAA

GAAACAGTAGTAAG ATTCTGAGATTTATTTCTGACTTCCTTGCTTTTTTGGTACTCTACAATTTCATCATTCCAATTTCTCTGTATGTGACAGTTGAGA

TGCAGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCACGAAGAGTCAGATCAGAAAGCTCAAGTCAATACTTCTGATCTGAATGA

AGAGCTTGGGCAG - UNI35745 - GTGGAATATGTATTTACAGATAAAACTGGAACACTGACAGAAAATGAGATGCAGTTTCGAGAATGTTCAATTA

ATGGCCTGAAATACCAAGAAATCAATGGTAAACTTGTACCTGAAGGACCAAGCCCAGACTCCACAGAAGGAGAAGTGCCTTTCCTTGGTAGTTTATCCCA

TCTCAGCAACTCAGCCCATCTCACAGCCACTTCTCTTAGAACCAGTCCTGAAAGTGAAACTGAGCTA ATCAAAGAACACGATCTGTTCTTTAAAGCAGT

CAGTCTTTGCCATACTGTACAGATCAGCAATGTTCAAACTGACGGCATCGGGGATGGTCCCTGGCAGCCCAACCTGGCACCTGCACAGCTGGAGTACTAT

GCATCTTCACCAGATGAAAAGGCTCTGGTGGAAGCTGCGGCAAG AGCTGGTATTATATTTGTAGGCATTTCTGAAGAAACTATGGAGGTTAAAGTACTT

GGGAGATTGGAAAG GTACAAATTGCTTCATATTCTGGAATTTGATTCAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAG GTGAGAAGCT

TTTATTTGCTAAAGGAGCAGAATCTTCAATTCTCCCTAAATGTATAGGTGGAGAAATAGCAAAAACCAGAATTCATGTTGATGAGTTTGCTTTG AAAGG

ACTGCGGACACTGTGTATAGCTTACAGACAGTTTACAGCTAAAGAGTATGAAGATGTAGACAGGCGCCTGTTTGAGGCCAGAACTGCCTTGCAGCATCGG

GAAGAGAAATTGGCTGATGCCTTCCAGTACATTGAGAAAGACCTGATATTGCTAGGAGCTACAGCAGTGGAAGACAG ACTACAAGATAAAGTTCGAGAA

ACTATTGAAGCACTGAGAATGGCTGGTATTAAAGTATGGGTACTTACTGGAGACAAACATGAAACAGCTGTTAGTGTGAGTTTATCTTGTGGACATTTTC

ATAGAACTATGAATATCCTGGAACTTATCAACCAGAAGTCAGATAGTGGATGTGCTGAACAGTTGAGGCAGCTTGCCAGAAG AATTACAGAGGACCATG

TGATTCAGCATGGGCTAGTAGTAGATGGGACCAGCTTATCTCTTGCACTCAGGGAACATGAAAAGCTCTTTATGGAAGTTTGCAGAAACTGTTCAGCTGT

ATTATGTTGTCGCATGGCACCTTTACAGAAAGCAAAA GTAATAAGACTGATAAAAATCTCTCCTGAGAAACCGATAACACTGGCTGTTGGTGATGGTGC

TAATGATGTAAGCATGATACAAGAAGCGCATGTTGGCATAG AATTCTTTCATTGGACTTAGTGGATTATTGCTATTGGCAGTGGTTCAGCAATGAGTGA

TTTAGTATTTCATCTACTCTGATCTGTCACTGTTATGGAAGTGTGAGGACCATGTGTAGCTCCTCTGAGGGATAAAGTTCTAGCTTAGAGGAGTCAGCCT

TGTCCAGGAAGCGTCTTCATGGTGTGTATGATGGCTAGACTTGAGGCTGGATCGTTGTATGTCTTAAAATCAACCCCTCCTCTTTGGGATAATAAATATT

AATTTTGAAACTTC
Translation
MWRWVRQQL - UNI12465 - - UNI21535 - GFDPPHQSDTRTIYIANRFPQNGLYTPQKFIDNRIISSK YTIWNFVPKNLFEQFRRVANFYFL

IIFLVQ LMIDTPTSPITSGLPLFFVITVTAIKQ - UNI37186 - GYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNIR VGDIVRIAKDEIFPA

DLVLLSSDRLDGSCHVTTASLDGETNLK THVSVPETAVLQTVANLDSLIAVIECQQPEADLYR - UNI18356 - RFMGRMIITQQMEEIVR RPLG

PESLLLRGARLKNTKEIFG GVAVYTGMETKMALNYKSKSQKRSAVEK KSMNTFLIIYLIILISEAIISTILKYTWQAEEKWDEPWYNQKTEHQRNSSK

 ILRFISDFLAFLVLYNFIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQ - UNI35745 - VEYVFTDKTGTLTENEMQF

RECSINGLKYQEINGKLVPEGPSPDSTEGEVPFLGSLSHLSNSAHLTATSLRTSPESETEL IKEHDLFFKAVSLCHTVQISNVQTDGIGDGPWQPNLAP

AQLEYYASSPDEKALVEAAAR RAGIIFVGISEETMEVKVLGRLER RYKLLHILEFDSDRRRMSVIVQAPSG GEKLLFAKGAESSILPKCIGGEIAKT

RIHVDEFAL KGLRTLCIAYRQFTAKEYEDVDRRLFEARTALQHREEKLADAFQYIEKDLILLGATAVEDR RLQDKVRETIEALRMAGIKVWVLTGDKH

ETAVSVSLSCGHFHRTMNILELINQKSDSGCAEQLRQLARR RITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRNCSAVLCCRMAPLQKAK VIRLI

KISPEKPITLAVGDGANDVSMIQEAHVGIE EFFHWT
Transcript ENSMUST00000029257
Sequence
GTGGCGGCGGCTCAGCGGGGAGTAGTGCTGCGCCGGGCGCGGTTGGCAGCCAGGCCGCGCCTGTAGGACCTCCGGGCCGGGGTGGCGGGATGGGGACCCG

ACTCGGGTAGAAAAGCGGGGACAGCAGAGAGCAGAACTTAAGCCCGAGGGGCTCGCCTGCTCCGGTCACACTCGGAGTCCTCTTCCACCTGCTGCCGCTC

GGTCCCGCGTCCGGCGGGCCACGACGGCGTCGGCGACGGCGGGGGCATGTGGCGCTGGGTCCGGCAGCAGCTG - UNI12465 - - UNI21535 - 

GGTTTTGACCCACCACATCAAAGTGACACAAGAACTATTTACATAGCCAACAGGTTTCCTCAGAATGGCCTTTACACACCTCAGAAATTTATAGATAACC

GGATCATTTCATCTAAG TATACTATATGGAATTTTGTTCCAAAAAATTTATTTGAACAGTTCAGAAGAGTGGCAAACTTTTATTTTCTTATTATATTTT

TGGTTCAG CTTATGATTGATACACCTACCAGTCCAATTACCAGTGGACTTCCATTATTCTTTGTGATAACAGTAACTGCCATAAAACAG - UNI3718

6 - GGTTATGAAGACTGGTTACGCCATAACTCAGATAATGAAGTAAACGGAGCTCCTGTCTATGTTGTCAGAAGTGGGGGGCTTGTAAAAACTCGATCC

AAAAACATTCGG GTGGGTGATATTGTTCGTATAGCCAAAGATGAAATTTTTCCTGCAGATTTGGTGCTTCTGTCCTCAGATCGACTTGATGGTTCATGT

CATGTGACAACTGCTAGTTTGGATGGAGAGACAAACCTAAAG ACACATGTGTCAGTTCCAGAAACAGCAGTATTACAAACAGTTGCCAACTTGGACAGT

CTCATAGCTGTAATAGAATGCCAACAGCCAGAAGCAGATTTATACAG - UNI18356 - ATTTATGGGACGAATGATAATAACTCAACAAATGGAAGA

AATTGTAAG ACCTCTGGGACCAGAGAGTCTCTTGCTTCGTGGAGCCAGATTAAAAAATACAAAAGAAATTTTTG GTGTGGCTGTATACACTGGAATGG

AAACTAAGATGGCACTAAATTACAAGAGCAAGTCACAGAAAAGATCTGCAGTAGAAAA ATCAATGAACACATTTTTAATAATTTACCTAATAATACTTA

TTTCTGAGGCCATCATCAGTACGATCTTGAAATATACCTGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGAAA

CAGTAGTAAG ATTCTGAGATTTATTTCTGACTTCCTTGCTTTTTTGGTACTCTACAATTTCATCATTCCAATTTCTCTGTATGTGACAGTTGAGATGCA

GAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCACGAAGAGTCAGATCAGAAAGCTCAAGTCAATACTTCTGATCTGAATGAAGAG

CTTGGGCAG - UNI35745 - GTGGAATATGTATTTACAGATAAAACTGGAACACTGACAGAAAATGAGATGCAGTTTCGAGAATGTTCAATTAATGG

CCTGAAATACCAAGAAATCAATGGTAAACTTGTACCTGAAGGACCAAGCCCAGACTCCACAGAAGGAGAAGTGCCTTTCCTTGGTAGTTTATCCCATCTC

AGCAACTCAGCCCATCTCACAGCCACTTCTCTTAGAACCAGTCCTGAAAGTGAAACTGAGCTA ATCAAAGAACACGATCTGTTCTTTAAAGCAGTCAGT

CTTTGCCATACTGTACAGATCAGCAATGTTCAAACTGACGGCATCGGGGATGGTCCCTGGCAGCCCAACCTGGCACCTGCACAGCTGGAGTACTATGCAT

CTTCACCAGATGAAAAGGCTCTGGTGGAAGCTGCGGCAAG AGCTGGTATTATATTTGTAGGCATTTCTGAAGAAACTATGGAGGTTAAAGTACTTGGGA

GATTGGAAAG GTACAAATTGCTTCATATTCTGGAATTTGATTCAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAG GTGAGAAGCTTTTA

TTTGCTAAAGGAGCAGAATCTTCAATTCTCCCTAAATGTATAGGTGGAGAAATAGCAAAAACCAGAATTCATGTTGATGAGTTTGCTTTG AAAGGACTG

CGGACACTGTGTATAGCTTACAGACAGTTTACAGCTAAAGAGTATGAAGATGTAGACAGGCGCCTGTTTGAGGCCAGAACTGCCTTGCAGCATCGGGAAG

AGAAATTGGCTGATGCCTTCCAGTACATTGAGAAAGACCTGATATTGCTAGGAGCTACAGCAGTGGAAGACAG ACTACAAGATAAAGTTCGAGAAACTA

TTGAAGCACTGAGAATGGCTGGTATTAAAGTATGGGTACTTACTGGAGACAAACATGAAACAGCTGTTAGTGTGAGTTTATCTTGTGGACATTTTCATAG

AACTATGAATATCCTGGAACTTATCAACCAGAAGTCAGATAGTGGATGTGCTGAACAGTTGAGGCAGCTTGCCAGAAG AATTACAGAGGACCATGTGAT

TCAGCATGGGCTAGTAGTAGATGGGACCAGCTTATCTCTTGCACTCAGGGAACATGAAAAGCTCTTTATGGAAGTTTGCAGAAACTGTTCAGCTGTATTA

TGTTGTCGCATGGCACCTTTACAGAAAGCAAAA GTAATAAGACTGATAAAAATCTCTCCTGAGAAACCGATAACACTGGCTGTTGGTGATGGTGCTAAT

GATGTAAGCATGATACAAGAAGCGCATGTTGGCATAG GAATCATGGGTAAAGAGGGAAGACAAGCTGCAAGAAACAGTGACTATGCAATAGCTAGATTT

AAATTTCTCTCCAAATTACTTTTTGTTCACGGTCATTTTTATTATATTAGAATAGCTACCCTTGTACAGTATTTTTTTTATAAG AATGTGTGCTTTATC

ACACCCCAGTTTTTATATCAGTTCTACTGTTTGTTTTCTCAACAA ACACTGTATGACAGCGTGTACCTGACTTTATACAATATCTGTTTTACTTCCCTA

CCTGTTCTCATATATAGTCTTGTGGAACAACATATAGACCCACACGTATTACAGAGCAAGCCTACCCTCTATCG GGACATTAGTAAAAACGGTCTCTTG

AGCATTAAAGCATTTCTTTACTGGACCGTCCTGGGTTTCAGCCATGCCTTCATTTTCTTCTTTGGATCCTACTTTCTAGTGGGGAAGGATACATCTTTGC

TTGGAAATGGTCAG ATGTTTGGAAACTGGACATTTGGTACTTTGGTCTTCACAGTCATGGTTATTACAGTCACAGTAAAG ATGGCATTGGAAACTCAT

TTCTGGACTTGGATCAACCATCTTGTTACCTGGGGATCTATTATATTTTATTTTATATTTTCTTTGTTTTATGGTGGAATTCTCTG GCCATTTTTGGGC

TCCCAGAATATGTACTTTGTATTTATTCAGCTCCTGTCAAGTGGGTCAGCTTGGTTTGCCATACTCCTCATGGTTGTTACATGTCTATTCATTGATGTTG

TGAAGAAAGTGTTTGATCGACAGCTTCATCCTACAAGTACAGAAAAGGCACAG CTTGCTGAAGCTCATTCCAGTGTCAAGTGCTTGGACTCCGTGTGCT

GTTTCCCAGGAGAGACCCCGTGTGCGTCTGTTGGAAGAATGCTGGAGCGAGTCATAGGACGGTGTAGTCCCAACCATATCAGCAG GTTGTGGAATGCAT

CGGATCCATTCTATACCAATGACAGGAGCATCTTGACTCTCTCGCCAATGGACTCATCTACTTGTTAAAGGGACAGTAGGACTTTGTGGAACAAGTTCAC

TTGTCCTCAGGTTTGGGGTCACCATCCAGTTGTAAAAGGCCAGTTACTTTCTGAAATCTCTTGAGGAATTGACACTTTCTCAGAGTCCATGGGAAACAGG

CAGTTATATGAACCCTTCTCCTTTCTCTTTAATTTGAATGTGAATATATTAAAATTTGGAGATAAAGAGATAGTAACAATCTCTTTGTCTGGTTTGTCCC

TTCTGATCATGGGACTCCTGGTGGCATTGCAGCCTTTGCTGAGGCCACTGTACTTTAATATCAAGGTAGAGAAAGGGGTCATTCTTGGTTATGTGTAGTT

TAAGATGAGGGTGGTTTGGGACTCTTCTATTTAAATCTGCTTCTGTAAATTTTGCTAAAGATTTGCCTTGAGAACTCTATTTTTTTTATTAGATTATATT

TGAAGCTTTTCGTGGGGAAAGTTAATGTGAATATCAAGGAATTTTGGTCCTTCAGTGACCTCTGTTAATTCATTAGTACTTTTTAAGTCACAGAGCAACT

AGGAGAGCACGTTTCTAACCACTGTCTTTTGCGGTGTGGGTAATAAGCTTATACTGACCCCACTTCTTTAACGATGCTGTAACCCAGCCAGTGACGCTAA

TCCTACAAGTGCAAAGGGAGTTTTGCATCTCATGTCCAAGTCAGAATTAGGGCCATTTACTAGACTTCAAATTGGTGTTTGCTAATATTTTTGTGGCCAA

GTATGTAAACTTGTAGTGGGTAAATTCAATACTTTTGTCATATTAATTTACTGTATCTGTCTTATCTTTTGCATGCTTCAACCTGGCTAATATATTTAAA

TCCACCGCATCTCTCCTCCCTCCCCCCATTATTACTTTCCTCTCTCTCCAAAGACTCTGTTCATAGTTTTATAACAATATTGTAAAGTTCAATTGTATCA

ATAAAAAAAAAAAACAAGTTTGGACAGTATTTAAATATTGCAAATATATTTAATTATATAAATTAAAATATAAGCCATAATGTCTTTCTTTGGCCCACTT

AGAATTGCTCTTGACTTGCTGTAAACCAACCTTCAGAATAAAGGACTTTTGTT
Translation
MWRWVRQQL - UNI12465 - - UNI21535 - GFDPPHQSDTRTIYIANRFPQNGLYTPQKFIDNRIISSK YTIWNFVPKNLFEQFRRVANFYFL

IIFLVQ LMIDTPTSPITSGLPLFFVITVTAIKQ - UNI37186 - GYEDWLRHNSDNEVNGAPVYVVRSGGLVKTRSKNIR VGDIVRIAKDEIFPA

DLVLLSSDRLDGSCHVTTASLDGETNLK THVSVPETAVLQTVANLDSLIAVIECQQPEADLYR - UNI18356 - RFMGRMIITQQMEEIVR RPLG

PESLLLRGARLKNTKEIFG GVAVYTGMETKMALNYKSKSQKRSAVEK KSMNTFLIIYLIILISEAIISTILKYTWQAEEKWDEPWYNQKTEHQRNSSK

 ILRFISDFLAFLVLYNFIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQ - UNI35745 - VEYVFTDKTGTLTENEMQF

RECSINGLKYQEINGKLVPEGPSPDSTEGEVPFLGSLSHLSNSAHLTATSLRTSPESETEL IKEHDLFFKAVSLCHTVQISNVQTDGIGDGPWQPNLAP

AQLEYYASSPDEKALVEAAAR RAGIIFVGISEETMEVKVLGRLER RYKLLHILEFDSDRRRMSVIVQAPSG GEKLLFAKGAESSILPKCIGGEIAKT

RIHVDEFAL KGLRTLCIAYRQFTAKEYEDVDRRLFEARTALQHREEKLADAFQYIEKDLILLGATAVEDR RLQDKVRETIEALRMAGIKVWVLTGDKH

ETAVSVSLSCGHFHRTMNILELINQKSDSGCAEQLRQLARR RITEDHVIQHGLVVDGTSLSLALREHEKLFMEVCRNCSAVLCCRMAPLQKAK VIRLI

KISPEKPITLAVGDGANDVSMIQEAHVGIG GIMGKEGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYK NVCFITPQFLYQFYCLFSQ

Q TLYDSVYLTLYNICFTSLPVLIYSLVEQHIDPHVLQSKPTLYR RDISKNGLLSIKAFLYWTVLGFSHAFIFFFGSYFLVGKDTSLLGNGQ MFGNWT

FGTLVFTVMVITVTVK MALETHFWTWINHLVTWGSIIFYFIFSLFYGGILW WPFLGSQNMYFVFIQLLSSGSAWFAILLMVVTCLFIDVVKKVFDRQL

HPTSTEKAQ LAEAHSSVKCLDSVCCFPGETPCASVGRMLERVIGRCSPNHISR RLWNASDPFYTNDRSILTLSPMDSSTC

For any suggestions or comments, please send an email to unitrap@crg.es