Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037405 (Icam1)
Chromosomal location
Chr 9: 20820429 - 20833252 (+)
Description
intercellular adhesion molecule 1 Gene [Source:MGI Symbol;Acc:MGI:96392]
RefSeq_dna
NM_010493 
RefSeq_peptide
NP_034623.1 
UniGene
Mm.435508 
MGI
MGI:96392 
Uniprot/SWISSPROT
P13597 
Uniprot/SPTREMBL
Q3TB10 Q3TB21 Q3THH5 Q3U7Q9 Q3U7T2 Q3U8M7 Q3UAU5 Q3UDC5 Q3UDJ5 Q3UE52 Q4FK06 Q922B3 
Human Ortholog
ENSG00000090339 (ICAM1)
Omim not available
UniTrap UNI11369
Vector Insertion
Chr 9: 20820546 - 20823362
Public Clones (sanger) G051E07 (ggtc) 5SE320B06 (ggtc) D014C08 (ggtc) 3SE320B06 (ggtc)
G020B09 (ggtc) 3SE320B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10131
Vector Insertion
Chr 9: 20823624 - 20829987
Public Clones Ex245 (baygenomics) XST102 (baygenomics) CMHD-GT_265A9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9142
Vector Insertion
Chr 9: 20830303 - 20830755
Public Clones RST502 (baygenomics) G070B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086399
Sequence
AGTGCTAGTGCTGAGCTCCGCTGCTACCTGCACTTTGCCCTGGCCCTGCAATGGCTTCAACCCGTGCCAAGCCCACGCTACCTCTGCTCCTGGCCCTGGT

CACCGTTGTGATCCCTG - UNI11369 - GGCCTGGTGATGCTCAGGTATCCATCCATCCCAGAGAAGCCTTCCTGCCCCAGGGTGGGTCCGTGCAGG

TGAACTGTTCTTCCTCATGCAAGGAGGACCTCAGCCTGGGCTTGGAGACTCAGTGGCTGAAAGATGAGCTCGAGAGTGGACCCAACTGGAAGCTGTTTGA

GCTGAGCGAGATCGGGGAGGACAGCAGTCCGCTGTGCTTTGAGAACTGTGGCACCGTGCAGTCGTCCGCTTCCGCTACCATCACCGTGTATT - UNI10

131 - CGTTTCCGGAGAGTGTGGAGCTGAGACCTCTGCCAGCCTGGCAGCAAGTAGGCAAGGACCTCACCCTGCGCTGCCACGTGGATGGTGGAGCACC

GCGGACCCAGCTCTCAGCAGTGCTGCTCCGTGGGGAGGAGATACTGAGCCGCCAGCCAGTGGGTGGGCACCCCAAGGACCCCAAGGAGATCACATTCACG

GTGCTGGCTAGCAGAGGGGACCACGGAGCCAATTTCTCATGCCGCACAGAACTGGATCTCAGGCCGCAAGGGCTGGCATTGTTCTCTAATGTCTCCGAGG

CCAGGAGCCTCCGGACTTTCG - UNI9142 - ATCTTCCAGCTACCATCCCAAAGCTCGACACCCCTGACCTCCTGGAGGTGGGCACCCAGCAGAAGT

TGTTTTGCTCCCTGGAAGGCCTGTTTCCTGCCTCTGAAGCTCGGATATACCTGGAGCTGGGAGGCCAGATGCCGACCCAGGAGAGCACAAACAGCAGTGA

CTCTGTGTCAGCCACTGCCTTGGTAGAGGTGACTGAGGAGTTCGACAGAACCCTGCCGCTGCGCTGCGTTTTGGAGCTAGCGGACCAGATCCTGGAGACG

CAGAGGACCTTAACAGTCTACA ACTTTTCAGCTCCGGTCCTGACCCTGAGCCAGCTGGAGGTCTCGGAAGGGAGCCAAGTAACTGTGAAGTGTGAAGCC

CACAGTGGGTCGAAGGTGGTTCTTCTGAGCGGCGTCGAGCCTAGGCCACCCACCCCGCAGGTCCAATTCACACTGAATGCCAGCTCGGAGGATCACAAAC

GAAGCTTCTTTTGCTCTGCCGCTCTGGAGGTGGCGGGAAAGTTCCTGTTTAAAAACCAGACCCTGGAACTGCACGTGCTGT ATGGTCCTCGGCTGGACG

AGACGGACTGCTTGGGGAACTGGACCTGGCAAGAGGGGTCTCAGCAGACTCTGAAATGCCAGGCCTGGGGGAACCCATCTCCTAAGATGACCTGCAGACG

GAAGGCAGATGGTGCCCTGCTGCCCATCGGGGTGGTGAAGTCTGTCAAACAGGAGATGAATGGTACATACGTGTGCCATGCCTTTAGCTCCCATGGGAAT

GTCACCAGGAATGTGTACCTGACAGTACTGT ACCACTCTCAAAATAACTGGACTATAATCATTCTGGTGCCAGTACTGCTGGTCATTGTGGGCCTCGTG

ATGGCAGCCTCTTATGTTTATAACCGCCAGAGAAAGATCAGGATATACAAGTTACAGAAGGCTCAGGAGGAGGCCATAAAACTCAAGGGACAAGCCCCAC

CTCCCTGAGCCTGCTGGATGAGACTCCTGCCTGGACCCCCTGCAGGGCAACAGCTGCTGCTGCTTTTGAACAGAATGGTAGACAGCATTTACCCTCAGCC

ACTTCCTCTGGCTGTCACAGAACAGGATGGTGGCCTGGGGGATGCACACTTGTAGCCTCAGAGCTAAGAGGACTCGGTGGATGGAGCAAGACTGTGAACA

CGTGTGACCCGGACCCACCTACAGCCCGGTGGACCTTCAGCCAAGAAACGCTGACTTCATTCTCTATTGCCCCTGCTGAGGGGCTCCTGCCTAAGGAAGA

CATGATATCCAGTAGACACAAGCAAGAAGACCACACTTCCCCCCGACACAGGAAAGCTGAGACATTGTCCCCAACTCTTCTTGATGTATTTATTAATTTA

GAGTTTTACCAGCTATTTATTGAGTACCCTGTATATAGTAGATCAGTGAGGAGGTGAATGTATAAGTTATGGCCTGGACCCTGCTGCAGATGCTGTGAGA

GTCTGGGGAAAGATCACATGGGTCGAGGGTTTCTCTACTGGTCAGGATGCTTTTCTCATAAGGGTCGACTTTTTTCACCAGTCACATAAACACTATGTGG

ACTGGCAGTGGTTCTCTGCTCCTCCACATCCTGGAGCGTCCCAGCACCTCCCCACCTACTTTTGTTCCCAATGTCAGCCACCATGCCTTAGCAGCTGAAC

AATCGAGCCTCATGCTCATGAAATCATGGTCCCAGGCGGCTCCACCTCAAAGAGAAAGCCTGGAAGGAAATGTTCCAACTCCTTAGAAGGGTCGTGCAAG

CTGCTGTGGGAGGGTAAGCACCCCTCCCAGCACAGAAACCTTTCCTTTGAATCAATAAAGTTTTATGTCG
Translation
MASTRAKPTLPLLLALVTVVIPG - UNI11369 - GPGDAQVSIHPREAFLPQGGSVQVNCSSSCKEDLSLGLETQWLKDELESGPNWKLFELSEIGE

DSSPLCFENCGTVQSSASATITVYS - UNI10131 - SFPESVELRPLPAWQQVGKDLTLRCHVDGGAPRTQLSAVLLRGEEILSRQPVGGHPKDPKE

ITFTVLASRGDHGANFSCRTELDLRPQGLALFSNVSEARSLRTFD - UNI9142 - DLPATIPKLDTPDLLEVGTQQKLFCSLEGLFPASEARIYLEL

GGQMPTQESTNSSDSVSATALVEVTEEFDRTLPLRCVLELADQILETQRTLTVYN NFSAPVLTLSQLEVSEGSQVTVKCEAHSGSKVVLLSGVEPRPPT

PQVQFTLNASSEDHKRSFFCSAALEVAGKFLFKNQTLELHVLY YGPRLDETDCLGNWTWQEGSQQTLKCQAWGNPSPKMTCRRKADGALLPIGVVKSVK

QEMNGTYVCHAFSSHGNVTRNVYLTVLY YHSQNNWTIIILVPVLLVIVGLVMAASYVYNRQRKIRIYKLQKAQEEAIKLKGQAPPP

For any suggestions or comments, please send an email to unitrap@crg.es