Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037410 (Tbc1d2b)
Chromosomal location
Chr 9: 90096889 - 90165607 (-)
Description
TBC1 domain family, member 2B Gene [Source:MGI (curated);Acc:Tbc1d2b-001]
RefSeq_dna
NM_194334 
RefSeq_peptide
NP_919315.2 
UniGene
Mm.335347 Mm.445551 
MGI
MGI:1914266 
Uniprot/SWISSPROT
Q3U0J8 
Uniprot/SPTREMBL
Q8K0Q9 
Human Ortholog
ENSG00000167202 (TBC1D2B)
Omim not available
UniTrap UNI34886
Vector Insertion
Chr 9: 90144628 - 90165608
Public Clones IST14995H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27857
Vector Insertion
Chr 9: 90110434 - 90113497
Public Clones not available
Private Clones OST45637 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22411
Vector Insertion
Chr 9: 90100061 - 90102610
Public Clones not available
Private Clones OST297811 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041767
Sequence
GGCGGCGGCCCGGAGGAGCGCGGGGCGGGAGCGCGGGCGCGGGCGCCGGCGGCAGGCCATGCCGGGGGCCGGGGACGGCGTGGAGGAGAGCTGCAGTGGT

GGTGAGGGAGCGGTACCGGGAACAGGCTCGGAGGCTGGGGCGGTGGCGGGACGGGAGCCCTCGCGGCTGTGCGGCTACCTGCAGAAGCTGTCGGGCAAGG

GCCCGTTGCGCGGCTACCGCAGCCGCTGGTTCGTGTTTGACTCGCGCCGCTGCTACCTCTACTACTTCAAGAGTCCCCAGGACGCTCTGCCGCTCGGCCA

CCTGGACATCGCCGACGCCTGCTTCAGCTACCAGGGCCGCGATGAGGCTGCGGAGCCCGGAGCAGATCCGCCCACACACTTCCAGGTGCACAGCGCCGGT

GCAGTCACCGTGCTCAAG - UNI34886 - GCTCCTAATCGTGAGCTCATGACTTACTGGCTACAGGAGCTTCAGCAGAAAAGATGGGAATATTGCAA

CAGCCTTGACATGATGAAGTGGGACAGCAGGACTTCCCCGACTCCAGGGGATTTTCCCAAGGGCCTTGTGGCCAGAGATACCACAG - UNI34886 - 

ATATAATTTCCCAGCACCCAAATCCTTCTGCAGAAAAAGCCAGAACTGTGCTCGCTGTGGAAGCTGCCCCTGGAGAGCTGGTGGGAGACCGGGCTGCTCA

TCAGCCAGCTCCCGGGCATCCGAATCCCATCAACTTTTACTCTCTGAAGCAGTGGGGAAATGAGCTCAA AAATTCAATGTCATCATTCCGTCCTGGGAG

AGGGCACAGTGAGAGTCGCAGGACCGTGTTTTACACCAATGAAGAGTGGGAACTTCTAGACCCGCCTCCTAAGGACCTGGAGGAGTCCCTGGTACCAGAA

GAGAGGAAGAAGCCGATGCCTGAGGGCAGTAAAG GAGTCGCTAGTTCAGGATTCCCCTTTGAATTTGGACGGAACCCTTACAAAGGAAAGCGCCCCTTG

AAAGATATAATTGGGTCATACAAAAACCGCCACAGCAGTAGTGATCCTTTGCTCGAGGGAACGGCGACATCATCAGGCAGCAGCGGAGGTCCCACTAAGC

CAGTCCCCGAAATGCAGCTGCAGATTCAAAGCCAGCAGGAGGAGCTGGAGCAACTCAAGAAGGACCTATCCAGTCAGAAG GAGCTCATTCGGCTGCTCC

AGCAGACAGTCCGGTCATCCCAATATGACAAGTATTTCACGAACCCCCAGATCAGCCAGGGGGTCCCCGGGGACACACTGGAGCTCCTGCACCAGAAGGA

CGAGCAGATCCTGGGCCTCAGCGGCCAGCTGGAGAGGTTCGGCCTGGAGAAGGAAAGCCTCCAGCAGGAAGTGAGGACGCTGAAGAGCAAGGTGGGCGAG

CTCAACGAGCGGCTCGGCATGCTGATGGAGACCATCCAGGCCAAGGACGAGGTCATCATCAAGCTCAGCGCCTGTGAGGGCAGCGTGTCATCACCCACCC

TGGGGCCCAGCTCTCCTTTGGCCATCCCAGCCAGCAAGGACCAGCTGGAGCTGGACAGGCTAAAA GATAGTCTGCAAGGGTACAAAAGCCAAAATAAAT

TTCTAAACAAGGAAATTTTGGAACTCTCGGCTCTACGAAGAAATGCAGAAAGGAGAGAGAGGGATCTGATGGCTAAG TACTCTAGCCTGGAAGCCAAGC

TCTGCCAGGTTGAAAGTAAATACTTGATACTGCTCCAAGAAATGAAGACACCAGTTTGCTCAGAGGAACAGGGCCCTGCCAGGGATGTCATAGCCCAGTT

GTTGGAGGATGCTCTGCAGGTCGAGAGCCAAGAGCAGCCGGAGCAAGCATTCGTTAAGCCTCATCTGGTCAG TGAGTTTGATATCTACGGGTTTAGGAC

TGTCCCTGATGATGATGAGGAAGAGAAGTTGGTCGCCAAGGTCCGAGCACTGGACCTGAAGACTCTGTACCTCACAGACAACCAGGAGGTTTCCACTGGG

GTCAAGTGGGAAAACTATTTTGCGAGCACAATGAACAGGGAGATGGCATGCTCTCCGGAGCTGAAAAACCTGATCCGAGCAGGCATTCCCCACGAGCACC

GCTCCAAGGTGTGGAAGTGGTGTGTTGACCGTCACACCAGGAAGTTCAAGGACAGCATGGAGCCAGACTACTTCCAGACCTTGCTGCAGAAGGCTCTGGA

GAAACAGAACCCGGCCTCCAAGCAGATCGAGCTGGACCTGCTCCGGACTCTGCCCAACAACAAGCACTACTCCAGCCCCACGTCGGAGGGCATACAGAAG

CTGCGCAGTGTCCTGCTCGCCTTCTCCTGGCGGAATCCCGATATCGGCTACTGCCAAGGCCTGAACAG - UNI27857 - GTTGGTGGCAGTGGCTCT

CCTTTACCTGGATCAAGAAGATGCCTTCTGGTGTCTCGTTACCATCGTGGAAGTCTTCATGCCCCGAGACTATTACACAAAGACTCTTTTAGGATCCCAG

 GTGGACCAGCGGGTGTTCAGAGACCTCCTGAGTGAGAAGCTGCCTCGACTGCACACCCATTTTGAACAGTACAAAGTGGACTACACCCTCATCACCTTC

AACTGGTTTCTGGTGGTATTTGTGGACAGCGTTGTCAGCGACATCCTCTTTAAAATATGGGACTCTTTCCTTTATGAGGGACCAAAG GTTATTTTCCGT

TTTGCCCTGGCACTTTTTAAATATAAGGAAGAGGAGATCCTGAAATTGCAAGATTCGATGTCCATATTCAAGTATCTGCGTTACTTCACTCGGACTATCC

TCGATGCCAG - UNI22411 - GAAGCTGATCAGCATCTCCTTTGGGGATCTGAACCCCTTCCCCCTGCGCCAGATCCGGAACCGGAGAGCCTACCAC

CTGGAGAAGGTCCGGCTGGAGCTGACAGAGCTGGAGGCCATTCGAGAGGACTTCCTGCGTGAGCGGGACACTAGCCCTGACAAAGGCGAGCTAGTTAGCG

ATGAGGAGGAAGACACTTGAATGGATCCCCACCCTAGGATGCTGCTCTTCTTGCCTTCCTTCATAACCAAAAGTAGCAAAGGCACATCACTGCACATCAG

CTGTCAGATTGTAACATCTACAGCCTCTGGCTTCTGCTGGGCAGATGTCCAGAGCTAAGCTGCACTTTCTCATCTCCCATTTCGGGGCAGGGGGCAGGTG

GCTTTACAGCCATTTCCGTGTCACATGCATCATATGCTTGCTGCCTGATTGGTGACTCACCGGGTGACTGTTTCCAAGGGCCTGTTTACAGCATCTGCCA

GTTGTGTGCGTGTTTCGCCCCACAAAAACTATGTTCCACATCTCCCTATGCTCTTTCTTTTACCCAAGGGCAGCACTGTGGAGGAATGTGCAGGGCGCCA

CAGTGTGGCTGCTTCCAGGGTCACAAGGTCACCATAAGAAGAGGGACCTCTTTAAAAAGCAAGCACACAACTGGCCTCCCAGGCTGGCGTGGGAGCCCTC

TGCTGGTGGCTTGGCACTGCCAGCCGCAGTCCCTTCTGGACTAGCCTTTGCTCTCCTATGTAGCCTTTCAGACTGCAGCACTCCCCCTGATCTGCAGCAG

TGCCCACACTTCTCACTGCCAGCTGCTTTGCCAGCTGTCTGTCCCAGATTGCAGTGGGGCTAAACACATCTCCAGGAGCTGCTGTAGGAAGCTCTTCTAG

CTGGGAGCTGACTTGTAGACACCATTCTCCAACTCTGGCTGGCTTGGGGTTCCAAAGGGACCTTGCAGTAGACCCAGCCCTGCATAAGGGAACATAGGAA

ACTCTCAGATCTGTGGCTTGTGGGCTCCTGGATTCAGGGCTCTAGAATCTCTCCTGCCTGACAGCTGGAGTGGGGCTGACTGCCAGCTTCCTGCATCTGG

AAGCACCTGGAGTGGTGAGTTCTAGTCTCTGTGTTGCCTGGATTATCCTTGTCTTCAACAGGGATCTGGGGCCACTATGGCCTCTGGAATAGCAGACTCT

GGGGACTTGGAACACTTCTTTCTTGAAGCCCAGAGAGGGTTTGAACAAGAAAGGTTATTTTTGCTCAGTCCCAGCGCATCGCTGATGGGTGACTGTCATG

AGAAAGCATGTTACACAGTATTATGGGAGCACAAGGGAAACAGCCTTGGACTACTTTACACTACCTGGGGGAAAATTGGAAACAATCCTTAGTGTAAACA

CACTCAGACTCAGGAGCGGAGCAAGACAGTTTCGAGAAGCGCTTTTTCCATGACCCATTTTCCTGTTTTTGCTGTCTGCTTTCTAGCACTTGAGTGGCTG

AGTCCATTTTTCAGTATCTAGACTATGCTTAACTTCTCCAAAAGTTGCTTCATTTATTACCATGTAAAAGGAGCTGGTCTCTCTATTTAGCCAATGGCCT

TTGCCTATCTTCAGGTATCAAAAATGTCATCCTTGTGTCTTTAGGATGGTGGTTTGAGGCCTGGTTTCTTCAGGAAGCTTGTCTGGAGCTGGACAGTGGT

CTTACTGCTATTCCAGAGCCTCCCTGAGACCAAATGCAGGGAGATGCCCCACCCCCTTGGAAGTGCCGGCTCTCAGCCTTGGGGACAGCTGTTAGGAAGT

GCCGCAGGGTAGGGTTGCCCCAGGGCTCAGTTGCCATGTCAGTTTCGTACCAGAAGATGCCAGTCCAGATGTGCATTTGGTGTAAATTTACTGGCGGGTT

GCTTTTGTCCTGTATGCTGGTGGAGGAGTCTTTAAAGCACCTGGTGATGCCGGGGACATGGCTTAGAACATGTGCCTGGTGTGTGGGACTCTGGGTTCCA

GCCCAGTGATTGGAAACGAAAATCTCCAATATGCATGGGGTCCTGTTCTGCCATTCCCTGAGAGACGGCATTAGTTTCTCAAGCAGTTAGCATCAGTGCT

CAGGTAAAAGTCTCAAGAGGCCCCAAGGGGAATGCACAAATGCACACTTAGAGGCTCTCATCCCTGGATAAATGACTCAGTGGCTTCAGAGCTGAGAAGG

AGGGCTTGCCCTCTTTCCAGTTTGGGGACAAAATGGCAGATGCTTGTCCCAGAGGCAAGGCTCCGGTGACTGAGCCATCTTCTCCCATTCCCTCATCACG

GAGACTGTCTTTACCCTCCTCTAGTGTTCCTGAGGTTCCAGACTTCTCCCAGCCACCGTGGCAGGTACCCCTCATGTCAGGGACTGCCTCGTGCTGCTTT

TCATCTGAACCTTTACCCAGCATGCAACGCATGGCTCCTGCCTGGTGAGCCTCGTGGGCTGAGAAAGCCAAAGCACAGCCTCCAGCGTGTGGGTCCAAAT

GCACGTGCCACAGTAGAGGAGCACCCTGCGCTTGGCGCCCCGTCTGGTGGGACCTACCGATATTCCAACCGTTGACACTTTTATATTTTCACTACATTTT

ATATTTTTATAGACTATTTTATATTAAGGTTTTTCTAGATCCTGTACAACTTTTATATAACAAGTTCTATTTTGTGTGCACGACTCCCCTGTATGTATTT

ATATCAACCCGAGCCTCCCAGATTGCAGGTCCCTCTTGTGCCACCTTTTCCTCTTAGCCTTGACTGTCCCTCTCCTCTGCTCACCCAGGTAGCCTCAGGG

GCTACTTCTAGCCGTGATAACACCCGAACAGCAGTCACTGGTCAGCATGTACTTCTCTGGTGTTTGTTAGCTGTGGTCTGTTGATACAGGAAGTACTCTG

GGCAGTACCCAGTCAGGTTACCACACTATGTTACCGCACAAACCCCTCTCCCTCAGTACAGTGGGTGTCCTGATGCAGCGACCTCTGGGTGGGTGGCTGG

TCAGGAAAGTCCTCGAAGACAGAGGCTAGATGCAAGCCCGATGTATGAGGCTCTGCTCCTGTGGGCAACTAGGGGACTTGAGGGCACACTGCCAAATGAC

TGTCCTTTCATATCACAGCAGCTTCCCTGCTCATCCTTGAGTTAAATGTAGACTTGTAAAGGAAGAAATAAACTAATTTTTATTACATTCTGCCTC
Translation
MPGAGDGVEESCSGGEGAVPGTGSEAGAVAGREPSRLCGYLQKLSGKGPLRGYRSRWFVFDSRRCYLYYFKSPQDALPLGHLDIADACFSYQGRDEAAEP

GADPPTHFQVHSAGAVTVLK - UNI34886 - APNRELMTYWLQELQQKRWEYCNSLDMMKWDSRTSPTPGDFPKGLVARDTTD - UNI34886 - 

DIISQHPNPSAEKARTVLAVEAAPGELVGDRAAHQPAPGHPNPINFYSLKQWGNELK KNSMSSFRPGRGHSESRRTVFYTNEEWELLDPPPKDLEESLV

PEERKKPMPEGSKG GVASSGFPFEFGRNPYKGKRPLKDIIGSYKNRHSSSDPLLEGTATSSGSSGGPTKPVPEMQLQIQSQQEELEQLKKDLSSQK EL

IRLLQQTVRSSQYDKYFTNPQISQGVPGDTLELLHQKDEQILGLSGQLERFGLEKESLQQEVRTLKSKVGELNERLGMLMETIQAKDEVIIKLSACEGSV

SSPTLGPSSPLAIPASKDQLELDRLK DSLQGYKSQNKFLNKEILELSALRRNAERRERDLMAK YSSLEAKLCQVESKYLILLQEMKTPVCSEEQGPAR

DVIAQLLEDALQVESQEQPEQAFVKPHLVS SEFDIYGFRTVPDDDEEEKLVAKVRALDLKTLYLTDNQEVSTGVKWENYFASTMNREMACSPELKNLIR

AGIPHEHRSKVWKWCVDRHTRKFKDSMEPDYFQTLLQKALEKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAFSWRNPDIGYCQGLNR - 

UNI27857 - RLVAVALLYLDQEDAFWCLVTIVEVFMPRDYYTKTLLGSQ VDQRVFRDLLSEKLPRLHTHFEQYKVDYTLITFNWFLVVFVDSVVSDI

LFKIWDSFLYEGPK VIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDAR - UNI22411 - RKLISISFGDLNPFPLRQIRNRRAYHLEKV

RLELTELEAIREDFLRERDTSPDKGELVSDEEEDT

For any suggestions or comments, please send an email to unitrap@crg.es