Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037426 (Depdc5)
Chromosomal location
Chr 5: 33206355 - 33334317 (+)
Description
DEP domain containing 5 Gene [Source:MGI (curated);Acc:Depdc5-002]
RefSeq_dna
NM_177786 NM_001025426 
RefSeq_peptide
NP_808454.1 NP_001020597.1 
UniGene
Mm.439888 
MGI
MGI:2141101 
Uniprot/SWISSPROT
P61460 
Uniprot/SPTREMBL
Q8BXW3 Q8BVE2 Q6GQV2 
Human Ortholog
ENSG00000100150 (DEPDC5)
Omim not available
UniTrap UNI23271
Vector Insertion
Chr 5: 33206471 - 33206658
Public Clones (sanger) IST15055D1 (tigm)
Private Clones OST267889 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17119
Vector Insertion
Chr 5: 33207225 - 33207349
Public Clones not available
Private Clones OST448981 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18643
Vector Insertion
Chr 5: 33207349 - 33210622
Public Clones not available
Private Clones OST418805 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27595
Vector Insertion
Chr 5: 33236103 - 33238528
Public Clones IST14248G6 (tigm)
Private Clones OST55789 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36249
Vector Insertion
Chr 5: 33247182 - 33253105
Public Clones IST12801B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15866
Vector Insertion
Chr 5: 33254895 - 33255748
Public Clones not available
Private Clones OST471279 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20448
Vector Insertion
Chr 5: 33260795 - 33266810
Public Clones not available
Private Clones OST362315 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25192
Vector Insertion
Chr 5: 33267015 - 33269538
Public Clones not available
Private Clones OST192289 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3440
Vector Insertion
Chr 5: 33287792 - 33289282
Public Clones AK0266 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30938
Vector Insertion
Chr 5: 33289417 - 33298501
Public Clones IST10890E6 (tigm) IST11007A3 (tigm) IST10890F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23215
Vector Insertion
Chr 5: 33301996 - 33307280
Public Clones (ggtc)
Private Clones OST270778 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25168
Vector Insertion
Chr 5: 33307433 - 33310379
Public Clones not available
Private Clones OST193127 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29245
Vector Insertion
Chr 5: 33310458 - 33311287
Public Clones not available
Private Clones OST2071 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10017
Vector Insertion
Chr 5: 33318194 - 33322033
Public Clones XE192 (baygenomics) XE268 (baygenomics) XE269 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36772
Vector Insertion
Chr 5: 33322204 - 33326507
Public Clones IST11715B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118698
Sequence
GGACTCGGGGCGGAGCCTCGGGAGCGGCGCGGGCTCAG - UNI17119 - - UNI23271 - TAGCAGGAAAGCAAGATGACTTCCCTGCTCCAAGA

TTGGAACAGCTGAAGAAATCACAAGACAAAATGAGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UNI17119 

- - UNI18643 - ATGATGAGCTAGTCGTGAACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATGATGAGTA

CAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTAAGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGGCTAAGAC

CTTATCAAGATGTCTATGTGAATGTTGTAGACCCCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAGGATCAGTATATTGGCCGTGGGGATA

TGTGGCGACTAAAGAAAAGTTTG GTGAGCACCTGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG GGCACAGGCTGGTGAGCTGTGGGTC

AAGAATGAGAAGGTCATGTGTGGTTACATTAGTGAAGAGACCAGG GTGGTGTTCCGTTCTACGTCGGCTATGGTTTACATATTTATTCAGATGAGCTGT

GAAATGTGGGATTTTGATATTTATG - UNI27595 - GGGATCTGTACTTTGAGAAAGCTGTGAACGGTTTCCTCGCCGACCTGTTTACTAA
Translation
 - UNI17119 - - UNI23271 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHPN

DEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR 

RAQAGELWVKNEKVMCGYISEETR VVFRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFT
Transcript ENSMUST00000049780
Sequence
TCCTAGAGCCCTGGTGCGGAAGCTGCGCGAACTGTGGGGGCTCAG - UNI17119 - - UNI23271 - TAGCAGGAAAGCAAGATGACTTCCCTGC

TCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATGAGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UN

I17119 - - UNI18643 - ATGATGAGCTAGTCGTGAACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATG

ATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTAAGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGG

CTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACCCCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAGGATCAGTATATTGGCCGT

GGGGATATGTGGCGACTAAAGAAAAGTTTG GTGAGCACCTGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG GGCACAGGCTGGTGAGCT

GTGGGTCAAGAATGAGAAGGTCATGTGTGGTTACATTAGTGAAGAGACCAGG GTGGTGTTCCGTTCTACGTCGGCTATGGTTTACATATTTATTCAGAT

GAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27595 - GGGATCTGTACTTTGAGAAAGCTGTGAACGGTTTCCTCGCCGACCTGTTTACTA

AATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGGTCCTGTTTTCCAGAACTTTCTATGATGCAAAATCTATTG ATGAATTTCCTGAAATAAAC

CGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATGAGGACTTTTACAA AGTGGTGGTGCAGAATGAGAGAAGGGAAGAGTGGACTTCACTCCTC

GTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGGTGCGACTGGAACAGGCAG GGGGCTTTCCTCAAGGAGACAATTCTACCTCAGCACAAGGA

AACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTTGACAAGCACTACATCAACCGAAACTTTGACCGAACTGGGCAGATGTCTGTGGTGATCACG

CCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGATCTTGACCAAGCAGCGGATGATTGATAATG GAATTGGTGTGGACTTAGTGTGCATGGGA

GAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACATAACCGGAGTGTTCCGAGGGATTCTCGACTGGGTGATGATTATAATATTCCTCACTGGATA

AACCATAG - UNI36249 - TTTCTACACATCCAAAAGCCAGCTCTTTTGTAACAGTTTCACTCCACGGATAAAACTAGCAGGAAAGAAG TCTGCCT

CTGAGAAAACCAAAAATGGTCGTGATACAT - UNI15866 - CTCTCGGGACTCCAAAGGAATCTGAAAACACCCTTCCCATCCAAGTAGATTATGAT

GCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCCGGGCTCAGCGCCTCGCCACCTGCAG GTCTGTGAGAGAACAGGAGAATCACAGTCGCAAA

AGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGCCAAGCCGTGCACTGCCCACTGAGGAAGTGAGGAGCCAGGCTTCTGATGACAGCTCCCTGG

GCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCTGCACCAGTATGAAGTCAGCAGCTCACTGGGCTACACCAGCACCCGAG - UNI20448 -

 ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACTCCAGTGCACCAGGAAGGTTCCATGTGGGTAGTGCAGAGTCCATGCTCCATGTCCGACCTG

GAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGCCCCCTCGAGGATGCCCATGAAGCTCACCTCCAACAGAAGGCGCTGGATGCACACTTTTCC

TGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCCAGATCCATCATCAGACCCGGCAAAACATGGCAGAGCTGCAGGGCAGCAGGCAGAGGGACC

CTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCATGAAGCTGCCGGGAG GCACAGCACTTCCCGCCAGCCTGGTGACAGCATGTCCTTGAACT

TCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAACAGCAGTACAG GTGTGAATCCTAGGACCCAGAACAAGGACTCCCTAGAGGACAGTGTTT

CTACCTCTCCAGACCCAA TGCCAGGCTTCTGTTGCACAGTTGGAGTGGATTGGAAGTCTCTTACTACTCCTGCATGCCTTCCCCTCACCACTGACTACT

TCCCGGACCGTCAGGGCCTGCAGAATGACTACACAGAGGGCTGCTATGATCTCCTCCCAGAAGCAGACATGGACAG GAGGGATGAGGAGGGTGTTCAAA

TGACAGCCCAGCAAGTGTTTGAAGAGTTCATCTGCCAGCGTCTCATGCAGGGTTACCAAATCATAGTACAGCCAAAGACCCAGAAACCCAACACCACAGT

CCCACCCCCATTGAGCAGTAGCCCACTCTATAGCAGAG GCCTTGTGTCCCGAAATCGCCCTGAGGAGGAAGGCCAGTATTGGTTAAGTATGGGCAGAAC

TTTCCATAAGGTGACACTCAAGGACAAGATGATCACAGTAACTCGTTACCTTCCCAA GTACCCTTATGAATCTGCCCAGATCCATTACACCTACAGCCT

CTGCCCTTCCCACTCTGACTCGGAGTTTGTCTCCTGTTGGGTGGATTTCTGCCACGAACGGCTCGAGGAATACAAGTGGAATTACTTAGATCAGTATATT

TGTTCTGCTGGCTCTGAAGACTTCAG CTTAATCGAGTCTCTGAAGTTCTGGAGAACCCGATTTTTACTACTGCCAGCCTGTGTTACTGCCACCAAGCGC

ATCACAGAAGGGGAGGTGCACTGTGACATCTATGGGGACAAACCCCGTGCAGATGAAGATGAGTGGCAGCTTCTAGATGGCTTTATTCGCTTTGTAGAGG

GCTTAAATCGCATCCGCAGGCGCCACCGCTCAGACCGCATGATTCGG - UNI3440 - AAGGGGACTGCCATGAAAGGCTTGCAGATGACCGGGCCCA

TCTCTGCACACTCTCTCGAGGCAGCAGGCCCTCCAGTCGGCAAGAAAGGAACCTCAGCTCTGTCTGCCCTGCTGGAGATGGAAGCTAGTCAGAA - UNI

30938 - GAGCCTAGGAGAACAGCAGACGACTGTGCACGGAAAAAGCTCCACTCAGCCAGCTGAGAACAGCAGTGTTGCCATGACTCCCACCTATGTGG

ACAGCCCACGCAAG GTGCAGCATGTGACCCGCACAGACTGAGATCTGACTTGAGCTTTGCAGTTTGCTATGTAGTTGTTCTTCACTGTTAACCATTCAC

TCTACTGGAGTGGAATTGGAAGTTCCTGAAGCACCGTCCACACAAGCCTGTACCTTTTTGATAATGGAGCTCCTATTCCTTGTTTTC
Translation
 - UNI17119 - - UNI23271 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHPN

DEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR 

RAQAGELWVKNEKVMCGYISEETR VVFRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVVL

FSRTFYDAKSID DEFPEINRASIQEDHKGRFYEDFYK KVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLSF

NV VFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS - 

UNI36249 - SFYTSKSQLFCNSFTPRIKLAGKK SASEKTKNGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQRL

ATCR RSVREQENHSRKSASSCDVSSSPSLPSRALPTEEVRSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLENM

IEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQGS

RQRDPTHSSAELLELAYHEAAGR RHSTSRQPGDSMSLNFSGTEELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPM MPGFCCTVGVDWKSLTTP

ACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDR RRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRG GLVSRNRP

EEEGQYWLSMGRTFHKVTLKDKMITVTRYLPK KYPYESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS SLIESLKFW

RTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTGPISAHSLEAA

GPPVGKKGTSALSALLEMEASQK - UNI30938 - KSLGEQQTTVHGKSSTQPAENSSVAMTPTYVDSPRK VQHVTRTD
Transcript ENSMUST00000114460
Sequence
CCTCGGGAGCGGCGCGGGCTCAGGTGAGCGCTCTTCGGTGGTGCTGTCTGTCTGGTTCCTAGAGCCCTGGTGCGGAAGCTGCGCGAACTGTGGGGGCTCA

G - UNI23271 - TTCCCCGTGTGACCTTGGACCAGTCTTTCTCTCACCAAGCTTCCCGGACCGCAGCGGTGAAATGGAGGCAGGACGGTCCGCTGAG

AGTTGGTACCAGTAGAGGGGTCGGCAAGGAAACCGCAGCCTTCCTCAGTTCTCTTTTCCCCAGGACATTGTTAGTGGACCGCGAGTCATGGGAGTGCATA

ACAGTTCGAGTGACCTTGGGCGAATCCCTTGTTTTGACGTTCCTCTACTTATGTGATGGACTAACCTCTTCGAATATCCCTGTACTATTTTGGTGTTCCT

GATGCAGACAAAAACAAG - UNI17119 - TAGCAGGAAAGCAAGATGACTTCCCTGCTCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATG

AGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UNI17119 - - UNI18643 - ATGATGAGCTAGTCGTGA

ACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATGATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTA

AGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGGCTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACC

CCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAGGATCAGTATATTGGCCGTGGGGATATGTGGCGACTAAAGAAAAGTTTG GTGAGCACC

TGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG GGCACAGGCTGGTGAGCTGTGGGTCAAGAATGAGAAGGTCATGTGTGGTTACATTAGT

GAAGAGACCAGG GTGGTGTTCCGTTCTACGTCGGCTATGGTTTACATATTTATTCAGATGAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27

595 - GGGATCTGTACTTTGAGAAAGCTGTGAACGGTTTCCTCGCCGACCTGTTTACTAAATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGG

TCCTGTTTTCCAGAACTTTCTATGATGCAAAATCTATTG ATGAATTTCCTGAAATAAACCGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATG

AGGACTTTTACAA AGTGGTGGTGCAGAATGAGAGAAGGGAAGAGTGGACTTCACTCCTCGTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGG

TGCGACTGGAACAGGCAG GGGGCTTTCCTCAAGGAGACAATTCTACCTCAGCACAAGGAAACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTT

GACAAGCACTACATCAACCGAAACTTTGACCGAACTGGGCAGATGTCTGTGGTGATCACGCCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGA

TCTTGACCAAGCAGCGGATGATTGATAATG GAATTGGTGTGGACTTAGTGTGCATGGGAGAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACAT

AACCGGAGTGTTCCGAGGGATTCTCGACTGGGTGATGATTATAATATTCCTCACTGGATAAACCATAG - UNI36249 - TTTCTACACATCCAAAAG

CCAGCTCTTTTGTAACAGTTTCACTCCACGGATAAAACTAGCAGGAAAGAAG TCTGCCTCTGAGAAAACCAAAAATGGTCGTGATACAT - UNI1586

6 - CTCTCGGGACTCCAAAGGAATCTGAAAACACCCTTCCCATCCAAGTAGATTATGATGCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCC

GGGCTCAGCGCCTCGCCACCTGCAG GTCTGTGAGAGAACAGGAGAATCACAGTCGCAAAAGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGC

CAAGCCGTGCACTGCCCACTGAGGAAGTGAGGAGCCAGGCTTCTGATGACAGCTCCCTGGGCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCT

GCACCAGTATGAAGTCAGCAGCTCACTGGGCTACACCAGCACCCGAG - UNI20448 - ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACT

CCAGTGCACCAGGAAGGTTCCATGTGGGTAGTGCAGAGTCCATGCTCCATGTCCGACCTGGAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGC

CCCCTCGAGGATGCCCATGAAGCTCACCTCCAACAGAAGGCGCTGGATGCACACTTTTCCTGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCC

AGATCCATCATCAGACCCGGCAAAACATGGCAGAGCTGCAGGGCAGCAGGCAGAGGGACCCTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCA

TGAAGCTGCCGGGAG GCACAGCACTTCCCGCCAGCCTGGTGACAGCATGTCCTTGAACTTCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAA

CAGCAGTACAG GTGTGAATCCTAGGACCCAGAACAAGGACTCCCTAGAGGACAGTGTTTCTACCTCTCCAGACCCAA TGCCAGGCTTCTGTTGCACAG

TTGGAGTGGATTGGAAGTCTCTTACTACTCCTGCATGCCTTCCCCTCACCACTGACTACTTCCCGGACCGTCAGGGCCTGCAGAATGACTACACAGAGGG

CTGCTATGATCTCCTCCCAGAAGCAGACATGGACAG GAGGGATGAGGAGGGTGTTCAAATGACAGCCCAGCAAGTGTTTGAAGAGTTCATCTGCCAGCG

TCTCATGCAGGGTTACCAAATCATAGTACAGCCAAAGACCCAGAAACCCAACACCACAGTCCCACCCCCATTGAGCAGTAGCCCACTCTATAGCAGAG G

CCTTGTGTCCCGAAATCGCCCTGAGGAGGAAGGCCAGTATTGGTTAAGTATGGGCAGAACTTTCCATAAGGTGACACTCAAGGACAAGATGATCACAGTA

ACTCGTTACCTTCCCAA GTACCCTTATGAATCTGCCCAGATCCATTACACCTACAGCCTCTGCCCTTCCCACTCTGACTCGGAGTTTGTCTCCTGTTGG

GTGGATTTCTGCCACGAACGGCTCGAGGAATACAAGTGGAATTACTTAGATCAGTATATTTGTTCTGCTGGCTCTGAAGACTTCAG CTTAATCGAGTCT

CTGAAGTTCTGGAGAACCCGATTTTTACTACTGCCAGCCTGTGTTACTGCCACCAAGCGCATCACAGAAGGGGAGGTGCACTGTGACATCTATGGGGACA

AACCCCGTGCAGATGAAGATGAGTGGCAGCTTCTAGATGGCTTTATTCGCTTTGTAGAGGGCTTAAATCGCATCCGCAGGCGCCACCGCTCAGACCGCAT

GATTCGG - UNI3440 - AAGGGGACTGCCATGAAAGGCTTGCAGATGACCGGGCCCATCTCTGCACACTCTCTCGAGGCAGCAGGCCCTCCAGTCGG

CAAGAAAGGAACCTCAGCTCTGTCTGCCCTGCTGGAGATGGAAGCTAGTCAGAA - UNI30938 - GAGCCTAGGAGAACAGCAGACGACTGTGCACG

GAAAAAGCTCCACTCAGCCAGCTGAGAACAGCAGTGTTGCCATGACTCCCACCTATGTGGACAGCCCACGCAAG GTGCAGCATGTGACCCGCACAGACT

GA
Translation
 - UNI23271 -  - UNI17119 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHP

NDEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR

 RAQAGELWVKNEKVMCGYISEETR VVFRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVV

LFSRTFYDAKSID DEFPEINRASIQEDHKGRFYEDFYK KVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLS

FNV VFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS -

 UNI36249 - SFYTSKSQLFCNSFTPRIKLAGKK SASEKTKNGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQR

LATCR RSVREQENHSRKSASSCDVSSSPSLPSRALPTEEVRSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLEN

MIEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQG

SRQRDPTHSSAELLELAYHEAAGR RHSTSRQPGDSMSLNFSGTEELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPM MPGFCCTVGVDWKSLTT

PACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDR RRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRG GLVSRNR

PEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPK KYPYESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS SLIESLKF

WRTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTGPISAHSLEA

AGPPVGKKGTSALSALLEMEASQK - UNI30938 - KSLGEQQTTVHGKSSTQPAENSSVAMTPTYVDSPRK VQHVTRTD
Transcript ENSMUST00000087897
Sequence
CCTCGGGAGCGGCGCGGGCTCAGGTGAGCGCTCTTCGGTGGTGCTGTCTGTCTGGTTCCTAGAGCCCTGGTGCGGAAGCTGCGCGAACTGTGGGGGCTCA

G - UNI23271 - TTCCCCGTGTGACCTTGGACCAGTCTTTCTCTCACCAAGCTTCCCGGACCGCAGCGGTGAAATGGAGGCAGGACGGTCCGCTGAG

AGTTGGTACCAGTAGAGGGGTCGGCAAGGAAACCGCAGCCTTCCTCAGTTCTCTTTTCCCCAGGACATTGTTAGTGGACCGCGAGTCATGGGAGTGCATA

ACAGTTCGAGTGACCTTGGGCGAATCCCTTGTTTTGACGTTCCTCTACTTATGTGATGGACTAACCTCTTCGAATATCCCTGTACTATTTTGGTGTTCCT

GATGCAGACAAAAACAAG - UNI17119 - TAGCAGGAAAGCAAGATGACTTCCCTGCTCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATG

AGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UNI17119 - - UNI18643 - ATGATGAGCTAGTCGTGA

ACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATGATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTA

AGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGGCTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACC

CCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAGGATCAGTATATTGGCCGTGGGGATATGTGGCGACTAAAGAAAAGTTTG GTGAGCACC

TGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG GGCACAGGCTGGTGAGCTGTGGGTCAAGAATGAGAAGGTCATGTGTGGTTACATTAGT

GAAGAGACCAGG GTGGTGTTCCGTTCTACGTCGGCTATGGTTTACATATTTATTCAGATGAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27

595 - GGGATCTGTACTTTGAGAAAGCTGTGAACGGTTTCCTCGCCGACCTGTTTACTAAATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGG

TCCTGTTTTCCAGAACTTTCTATGATGCAAAATCTATTG ATGAATTTCCTGAAATAAACCGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATG

AGGACTTTTACAA AGTGGTGGTGCAGAATGAGAGAAGGGAAGAGTGGACTTCACTCCTCGTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGG

TGCGACTGGAACAGGCAG GGGGCTTTCCTCAAGGAGACAATTCTACCTCAGCACAAGGAAACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTT

GACAAGCACTACATCAACCGAAACTTTGACCGAACTGGGCAGATGTCTGTGGTGATCACGCCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGA

TCTTGACCAAGCAGCGGATGATTGATAATG GAATTGGTGTGGACTTAGTGTGCATGGGAGAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACAT

AACCGGAGTGTTCCGAGGGATTCTCGACTGGGTGATGATTATAATATTCCTCACTGGATAAACCATAG - UNI36249 - TTTCTACACATCCAAAAG

CCAGCTCTTTTGTAACAGTTTCACTCCACGGATAAAACTAGCAGGAAAGAAG TCTGCCTCTGAGAAAACCAAAAATGGTCGTGATACAT - UNI1586

6 - CTCTCGGGACTCCAAAGGAATCTGAAAACACCCTTCCCATCCAAGTAGATTATGATGCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCC

GGGCTCAGCGCCTCGCCACCTGCAG GTCTGTGAGAGAACAGGAGAATCACAGTCGCAAAAGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGC

CAAGCCGTGCACTGCCCACTGAGGAAGTGAGGAGCCAGGCTTCTGATGACAGCTCCCTGGGCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCT

GCACCAGTATGAAGTCAGCAGCTCACTGGGCTACACCAGCACCCGAG - UNI20448 - ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACT

CCAGTGCACCAGGAAGGTTCCATGTGGGTAGTGCAGAGTCCATGCTCCATGTCCGACCTGGAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGC

CCCCTCGAGGATGCCCATGAAGCTCACCTCCAACAGAAGGCGCTGGATGCACACTTTTCCTGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCC

AGATCCATCATCAGACCCGGCAAAACATGGCAGAGCTGCAGGGCAGCAGGCAGAGGGACCCTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCA

TGAAGCTGCCGGGAG GCACAGCACTTCCCGCCAGCCTGGTGACAGCATGTCCTTGAACTTCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAA

CAGCAGTACAG GTGTGAATCCTAGGACCCAGAACAAGGACTCCCTAGAGGACAGTGTTTCTACCTCTCCAGACCCAA TTCTGACACTGTCTGCTCCCC

CTGTAGTGCCAGGCTTCTGTTGCACAGTTGGAGTGGATTGGAAGTCTCTTACTACTCCTGCATGCCTTCCCCTCACCACTGACTACTTCCCGGACCGTCA

GGGCCTGCAGAATGACTACACAGAGGGCTGCTATGATCTCCTCCCAGAAGCAGACATGGACAG GAGGGATGAGGAGGGTGTTCAAATGACAGCCCAGCA

AGTGTTTGAAGAGTTCATCTGCCAGCGTCTCATGCAGGGTTACCAAATCATAGTACAGCCAAAGACCCAGAAACCCAACACCACAGTCCCACCCCCATTG

AGCAGTAGCCCACTCTATAGCAGAG GCCTTGTGTCCCGAAATCGCCCTGAGGAGGAAGGCCAGTATTGGTTAAGTATGGGCAGAACTTTCCATAAGGTG

ACACTCAAGGACAAGATGATCACAGTAACTCGTTACCTTCCCAA GTACCCTTATGAATCTGCCCAGATCCATTACACCTACAGCCTCTGCCCTTCCCAC

TCTGACTCGGAGTTTGTCTCCTGTTGGGTGGATTTCTGCCACGAACGGCTCGAGGAATACAAGTGGAATTACTTAGATCAGTATATTTGTTCTGCTGGCT

CTGAAGACTTCAG CTTAATCGAGTCTCTGAAGTTCTGGAGAACCCGATTTTTACTACTGCCAGCCTGTGTTACTGCCACCAAGCGCATCACAGAAGGGG

AGGTGCACTGTGACATCTATGGGGACAAACCCCGTGCAGATGAAGATGAGTGGCAGCTTCTAGATGGCTTTATTCGCTTTGTAGAGGGCTTAAATCGCAT

CCGCAGGCGCCACCGCTCAGACCGCATGATTCGG - UNI3440 - AAGGGGACTGCCATGAAAGGCTTGCAGATGACCGGGCCCATCTCTGCACACTC

TCTCGAGGCAGCAGGCCCTCCAGTCGGCAAGAAAGGAACCTCAGCTCTGTCTGCCCTGCTGGAGATGGAAGCTAGTCAGAA - UNI30938 - GAGCC

TAGGAGAACAGCAGACGACTGTGCACGGAAAAAGCTCCACTCAGCCAGCTGAGAACAGCAGTGTTGCCATGACTCCCACCTATGTGGACAGCCCACGCAA

G GACGGGGCCTTCTTTATGGAGTTTGTCCGCAGCCCACGCACAGCATCATCTGCCTTCTACCCTCAG - UNI23215 - GCATCTGTGGACCAAACA

GCTCCTCTGGTGTTAGACAGCACCAGTTTAGGGGTCAGCACAGGCCAGCCCATGGATAGAGGCAACAACCAGACCTTTGGGAACTCCCAGAACATAGAAC

AGGCCTTTCCCTCTGCAAACTCTGGTGACTACAG - UNI25168 - CTCTCAGCAGCATGTAGCAAGCTCTCTAACATCGTCTTCTACCCTGGTGGAG

ATTCTGGAAGCCATGAAGCATCCCTC - UNI29245 - GACAGGAGTCCAGCTGCTGTCTGAACAGAAGGGCCTTTCACCGTGCTGCTTCATCAGTGC

TGAGGTCGTACACTGGTTGATGAACAACGTGGAGGGGGTCCAGACGCAGGCGATGGGCATAGACATCATGCAG AAAATGCTGGAAGAGCAGCTCATAAC

GCATGCATCTGGTGAAGCATGGCGGACCTTCATCTATGGCTTCTATTTCTACAAGATAGTAATGGACAAAGAACCGGAAAGAG TGGCTATGCAGCAGCC

CTCTGCCCCCTGGTACACAGCAGGAGCGGATGACTTTGCCAGCTTCCAACGCAAGTGGTTTGAGGTGGCCTTTGTGGCAGAAGAGCTTGTGCACTCTGAG

ATTCCTGCCTTCCTCCTGCCCTGGCTACCTAGCCGGCCAGCCTCTTATGCAAGCAGACACAGCTCCTTTAGCCGAAGTTTTGGAGGACGGAGCCAGGCAG

CTGCGCTGTTAG - UNI10017 - CTGCTACTGTCCCAGAGCAGAGGACTGTGACCCTGGATGTTGATGTGAACAACCGAACGGACCGGCTGGAATGG

TGCAGCTGTTACTACCATGGAAACTTCTCTCTCAATGCCGCCTTTGAGATCAAGCTACACTGGATGGCAGTGACTGCCACAGTGCTGTTTGAGATG - U

NI36772 - GTCCAAGGTTGGCATCGAAAAGCTACCTCCTGTGGCTTCTTGCTGGTCCCAGTTTTGGAGGGTCCTTTTGCTCTGCCCAGTTACCTGTAT

GGTGATCCCCTGAGGGCCCAGCTCTTCATCCCGCTCAACCTCAGCTGCTTGCTCAAGGAGGGCAGCGAGCACCTGTTCGATA GTTTGGATTTGTGCAAG

ATAAATATTCTGTCTCCGCTTTTAACTTCCCTGCTGAGAATAAGCCACAGTATATCCATGTCACAG GAACGGTGTTCCTTCAGCTGCCGTACTCCAAAC

GCAAGTTTTCAGGGCAGCAGCGGCGGCGACGGAACTCTACCAGCTCCACCAACCAAAACATGTTCTGTGAGGAGCGGGTTGGCTACAACTGGGCCTACAA

CACCATGCTGACCAAGACATGGCGCTCTAGTGCCACAGGGGACGAGAAGTTTGCTGATCGGCTGCTGAAGGACTTCACGGATTTCTGCATCAACCGTGAC

AACCGACTGGTCACGTTCTGGACAAACTGCCTGGAGAAGATGCATGCCAGTGCTCCATGAAGCCAGGCTGCTTCTCTTAAGAGAGGCTGTGGGTATGCTG

GAGCTGGCCTTCCGGTCAGGCTCTGGGCAGCAGGTGTCAGGCTGCTCCTATCAGTGAGTGGGGCCACTGCTGATATTTGGCCTCTGCACAAGTGTGAGTG

AAGAGAAAGATTGGAAGCAGCTGCTGCCGCTACCGCCAACCAAATCTTGCCAATCCTGTCCCTGAAGCAGGGGGAGGCACAGATTGTCCGTGGGAGTGAG

TCAGTGTCTGGGAGTGGGGTAGGCAGCTTCCATTAGGGTCCTTTTCCTTCACCAGCAGTGGGATATTCGGAACAGAACCTCCTGCTTTC
Translation
 - UNI23271 -  - UNI17119 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHP

NDEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR

 RAQAGELWVKNEKVMCGYISEETR VVFRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVV

LFSRTFYDAKSID DEFPEINRASIQEDHKGRFYEDFYK KVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLS

FNV VFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS -

 UNI36249 - SFYTSKSQLFCNSFTPRIKLAGKK SASEKTKNGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQR

LATCR RSVREQENHSRKSASSCDVSSSPSLPSRALPTEEVRSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLEN

MIEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQG

SRQRDPTHSSAELLELAYHEAAGR RHSTSRQPGDSMSLNFSGTEELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPI ILTLSAPPVVPGFCCTV

GVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDR RRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSR

G GLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPK KYPYESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS

 SLIESLKFWRTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTG

PISAHSLEAAGPPVGKKGTSALSALLEMEASQK - UNI30938 - KSLGEQQTTVHGKSSTQPAENSSVAMTPTYVDSPRK DGAFFMEFVRSPRTAS

SAFYPQ - UNI23215 - ASVDQTAPLVLDSTSLGVSTGQPMDRGNNQTFGNSQNIEQAFPSANSGDYS - UNI25168 - SSQQHVASSLTSSST

LVEILEAMKHPS - UNI29245 - STGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQ KMLEEQLITHASGEAWRTFIYGFYFYKI

VMDKEPERV VAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLA - UNI10017 -

 AATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEM - UNI36772 - VQGWHRKATSCGFLLVPVLEGPFALPSY

LYGDPLRAQLFIPLNLSCLLKEGSEHLFDS SLDLCKINILSPLLTSLLRISHSISMSQ ERCSFSCRTPNASFQGSSGGDGTLPAPPTKTCSVRSGLAT

TGPTTPC
Transcript ENSMUST00000120902
Sequence
GCAAGATGACTTCCCTGCTCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATGAGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGC

TTTGGGGGCAGTG - UNI17119 - - UNI18643 - ATGATGAGCTAGTCGTGAACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGG

AGATTGCTCACCCCAATGATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTAAGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACT

GTGACTCAAGTATTCCGGCTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACCCCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAG

GATCAGTATATTGGCCGTGGGGATATGTGGCGACTAAAGAAAAGTTTG GTGAGCACCTGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG 

GGCACAGGCTGGTGAGCTGTGGGTCAAGAATGAGAAGGTCATGTGTGGTTACATTAGTGAAGAGACCAGG GTGGTGTTCCGTTCTACGTCGGCTATGGT

TTACATATTTATTCAGATGAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27595 - GGGATCTGTACTTTGAGAAAGCTGTGAACGGTTTCC

TCGCCGACCTGTTTACTAAATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGGTCCTGTTTTCCAGAACTTTCTATGATGCAAAATCTATTG AT

GAATTTCCTGAAATAAACCGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATGAGGACTTTTACAA AGTGGTGGTGCAGAATGAGAGAAGGGAA

GAGTGGACTTCACTCCTCGTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGGTGCGACTGGAACAGGCAG GGGGCTTTCCTCAAGGAGACAAT

TCTACCTCAGCACAAGGAAACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTTGACAAGCACTACATCAACCGAAACTTTGACCGAACTGGGCAG

ATGTCTGTGGTGATCACGCCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGATCTTGACCAAGCAGCGGATGATTGATAATG GAATTGGTGTG

GACTTAGTGTGCATGGGAGAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACATAACCGGAGTGTTCCGAGGGATTCTCGACTGGGTGATGATTAT

AATATTCCTCACTGGATAAACCATAG - UNI36249 - TTTCTACACATCCAAAAGCCAGCTCTTTTGTAACAGTTTCACTCCACGGATAAAACTAGC

AGGAAAGAAG TCTGCCTCTGAGAAAACCAAAAATGGTCGTGATACAT - UNI15866 - CTCTCGGGACTCCAAAGGAATCTGAAAACACCCTTCCC

ATCCAAGTAGATTATGATGCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCCGGGCTCAGCGCCTCGCCACCTGCAG GTCTGTGAGAGAACAG

GAGAATCACAGTCGCAAAAGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGCCAAGCCGTGCACTGCCCACTGAGGAAGTGAGGAGCCAGGCTT

CTGATGACAGCTCCCTGGGCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCTGCACCAGTATGAAGTCAGCAGCTCACTGGGCTACACCAGCAC

CCGAG - UNI20448 - ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACTCCAGTGCACCAGGAAGGTTCCATGTGGGTAGTGCAGAGTCCA

TGCTCCATGTCCGACCTGGAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGCCCCCTCGAGGATGCCCATGAAGCTCACCTCCAACAGAAGGCG

CTGGATGCACACTTTTCCTGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCCAGATCCATCATCAGACCCGGCAAAACATGGCAGAGCTGCAGG

GCAGCAGGCAGAGGGACCCTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCATGAAGCTGCCGGGAG GCACAGCACTTCCCGCCAGCCTGGTG

ACAGCATGTCCTTGAACTTCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAACAGCAGTACAG GTGTGAATCCTAGGACCCAGAACAAGGACT

CCCTAGAGGACAGTGTTTCTACCTCTCCAGACCCAA TGCCAGGCTTCTGTTGCACAGTTGGAGTGGATTGGAAGTCTCTTACTACTCCTGCATGCCTTC

CCCTCACCACTGACTACTTCCCGGACCGTCAGGGCCTGCAGAATGACTACACAGAGGGCTGCTATGATCTCCTCCCAGAAGCAGACATGGACAG GAGGG

ATGAGGAGGGTGTTCAAATGACAGCCCAGCAAGTGTTTGAAGAGTTCATCTGCCAGCGTCTCATGCAGGGTTACCAAATCATAGTACAGCCAAAGACCCA

GAAACCCAACACCACAGTCCCACCCCCATTGAGCAGTAGCCCACTCTATAGCAGAG GCCTTGTGTCCCGAAATCGCCCTGAGGAGGAAGGCCAGTATTG

GTTAAGTATGGGCAGAACTTTCCATAAGGTGACACTCAAGGACAAGATGATCACAGTAACTCGTTACCTTCCCAA GTACCCTTATGAATCTGCCCAGAT

CCATTACACCTACAGCCTCTGCCCTTCCCACTCTGACTCGGAGTTTGTCTCCTGTTGGGTGGATTTCTGCCACGAACGGCTCGAGGAATACAAGTGGAAT

TACTTAGATCAGTATATTTGTTCTGCTGGCTCTGAAGACTTCAG CTTAATCGAGTCTCTGAAGTTCTGGAGAACCCGATTTTTACTACTGCCAGCCTGT

GTTACTGCCACCAAGCGCATCACAGAAGGGGAGGTGCACTGTGACATCTATGGGGACAAACCCCGTGCAGATGAAGATGAGTGGCAGCTTCTAGATGGCT

TTATTCGCTTTGTAGAGGGCTTAAATCGCATCCGCAGGCGCCACCGCTCAGACCGCATGATTCGG - UNI3440 - AAGGGGACTGCCATGAAAGGCT

TGCAGATGACCGGGCCCATCTCTGCACACTCTCTCGAGGCAGCAGGCCCTCCAGTCGGCAAGAAAGGAACCTCAGCTCTGTCTGCCCTGCTGGAGATGGA

AGCTAGTCAGAA - UNI30938 - GAGCCTAGGAGAACAGCAGACGACTGTGCACGGAAAAAGCTCCACTCAGCCAGCTGAGAACAGCAGTGTTGCCA

TGACTCCCACCTATGTGGACAGCCCACGCAAG - UNI23215 - GCATCTGTGGACCAAACAGCTCCTCTGGTGTTAGACAGCACCAGTTTAGGGGTC

AGCACAGGCCAGCCCATGGATAGAGGCAACAACCAGACCTTTGGGAACTCCCAGAACATAGAACAGGCCTTTCCCTCTGCAAACTCTGGTGACTACAG -

 UNI25168 - CTCTCAGCAGCATGTAGCAAGCTCTCTAACATCGTCTTCTACCCTGGTGGAGATTCTGGAAGCCATGAAGCATCCCTC - UNI2924

5 - GACAGGAGTCCAGCTGCTGTCTGAACAGAAGGGCCTTTCACCGTGCTGCTTCATCAGTGCTGAGGTCGTACACTGGTTGATGAACAACGTGGAGGG

GGTCCAGACGCAGGCGATGGGCATAGACATCATGCAG AAAATGCTGGAAGAGCAGCTCATAACGCATGCATCTGGTGAAGCATGGCGGACCTTCATCTA

TGGCTTCTATTTCTACAAGATAGTAATGGACAAAGAACCGGAAAGAG TGGCTATGCAGCAGCCCTCTGCCCCCTGGTACACAGCAGGAGCGGATGACTT

TGCCAGCTTCCAACGCAAGTGGTTTGAGGTGGCCTTTGTGGCAGAAGAGCTTGTGCACTCTGAGATTCCTGCCTTCCTCCTGCCCTGGCTACCTAGCCGG

CCAGCCTCTTATGCAAGCAGACACAGCTCCTTTAGCCGAAGTTTTGGAGGACGGAGCCAGGCAGCTGCGCTGTTAG - UNI10017 - CTGCTACTGT

CCCAGAGCAGAGGACTGTGACCCTGGATGTTGATGTGAACAACCGAACGGACCGGCTGGAATGGTGCAGCTGTTACTACCATGGAAACTTCTCTCTCAAT

GCCGCCTTTGAGATCAAGCTACACTGGATGGCAGTGACTGCCACAGTGCTGTTTGAGATG - UNI36772 - GTCCAAGGTTGGCATCGAAAAGCTAC

CTCCTGTGGCTTCTTGCTGGTCCCAGTTTTGGAGGGTCCTTTTGCTCTGCCCAGTTACCTGTATGGTGATCCCCTGAGGGCCCAGCTCTTCATCCCGCTC

AACCTCAGCTGCTTGCTCAAGGAGGGCAGCGAGCACCTGTTCGATA GCTTTGAACCAGAGACATATTGGGATCGAATGCATCTTTTCCAGGAAGCCATT

GCACACAG GTTTGGATTTGTGCAAGATAAATATTCTGTCTCCGCTTTTAACTTCCCTGCTGAGAATAAGCCACAGTATATCCATGTCACAG GAACGGT

GTTCCTTCAGCTGCCGTACTCCAAACGCAAGTTTTCAGGGCAGCAGCGGCGGCGACGGAACTCTACCAGCTCCACCAACCAAAACATGTTCTGTGAGGAG

CGGGTTGGCTACAACTGGGCCTACAACACCATGCTGACCAAGACATGGCGCTCTAGTGCCACAGGGGACGAGAAGTTTGCTGATCGGCTGCTGAAGGACT

TCACGGATTTCTGCATCAACCGTGACAACCGACTGGTCACGTTCTGGACAAACTGCCTGGAGAAGATGCATGCCAGTGCTCCATGAAGCCAGGCTGCTTC

TCTTAAGAGAGGCTGTGGGTATGCTGGAGCTGGCCTTCCGGTCAGGCTCTGGGCAGCAGGTGTCAGGCTGCTCCTATCAGTGAGTGGGGCCACTGCTGAT

ATTTGGCCTCTGCACAAGTGTGAGTGAAGAGAAAGATTGGAAGCAGCTGCTGCCGCTACCGCCAACCAAATCTTGCCAATCCTGTCCCTGAAGCAGGGGG

AGGCACAGATTGTCCGTGGGAGTGAGTCAGTGTCTGGGAGTGGGGTAGGCAGCTTCCATTAGGGTCCTTTTCCTTCACCAGCAGTGGGATATTCGGAACA

GAACCTCCTGCTTTCTGCCCAAGAGTGTGTGTATGAGGTAAATCTGTGGCATAATGTACCATTGGCTCACACCAGCTGTACATATGTGTACATAGCAGAA

TCTAATAAAGCCCTCC
Translation
MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHPNDEYS SPLLLQVKSLKEDLQKE ETIS

VDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR RAQAGELWVKNEKVMCGYISEETR VV

FRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVVLFSRTFYDAKSID DEFPEINRASIQED

HKGRFYEDFYK KVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLSFNV VFDKHYINRNFDRTGQMSVVITPG

VGVFEVDRLLMILTKQRMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS - UNI36249 - SFYTSKSQLFCNSFTP

RIKLAGKK SASEKTKNGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQRLATCR RSVREQENHSRKSASSCDVSSS

PSLPSRALPTEEVRSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLENMIEPPQRDSSAPGRFHVGSAESMLHVRP

GGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQGSRQRDPTHSSAELLELAYHEAAGR RHS

TSRQPGDSMSLNFSGTEELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPM MPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDL

LPEADMDR RRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRG GLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVT

RYLPK KYPYESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS SLIESLKFWRTRFLLLPACVTATKRITEGEVHCDIY

GDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQK - U

NI30938 - KSLGEQQTTVHGKSSTQPAENSSVAMTPTYVDSPRK - UNI23215 - ASVDQTAPLVLDSTSLGVSTGQPMDRGNNQTFGNSQNIEQ

AFPSANSGDYS - UNI25168 - SSQQHVASSLTSSSTLVEILEAMKHPS - UNI29245 - STGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGV

QTQAMGIDIMQ KMLEEQLITHASGEAWRTFIYGFYFYKIVMDKEPERV VAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPS

RPASYASRHSSFSRSFGGRSQAAALLA - UNI10017 - AATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEM -

 UNI36772 - VQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEGSEHLFDS SFEPETYWDRMHLFQEAIAHR RFGFVQD

KYSVSAFNFPAENKPQYIHVTG GTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINR

DNRLVTFWTNCLEKMHASAP
Transcript ENSMUST00000119705
Sequence
GCGGGCTCAGGTGAGCGCTCTTCGGTGGTGCTGTCTGTCTGGTTCCTAGAGCCCTGGTGCGGAAGCTGCGCGAACTGTGGGGGCTCAG - UNI17119 

- - UNI23271 - TAGCAGGAAAGCAAGATGACTTCCCTGCTCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATGAGAACCACAAAGGTCTA

CAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UNI17119 - - UNI18643 - ATGATGAGCTAGTCGTGAACCCTAAAGTATTTCCT

CACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATGATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTAAGGAAGATTTACAGAAA

G AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGGCTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACCCCAAG GATGTGACTCT

TGACCTGGTGGAATTGACTTTTAAGGATCAGTATATTGGCCGTGGGGATATGTGGCGACTAAAGAAAAGTTTG GTGAGCACCTGTGCCTATATCACTCA

AAAAGTGGAATTTGCTGGCATCAG GGCACAGGCTGGTGAGCTGTGGGTCAAGAATGAGAAGGTCATGTGTGGTTACATTAGTGAAGAGACCAGG GTGG

TGTTCCGTTCTACGTCGGCTATGGTTTACATATTTATTCAGATGAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27595 - GGGATCTGTAC

TTTGAGAAAGCTGTGAACGGTTTCCTCGCCGACCTGTTTACTAAATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGGTCCTGTTTTCCAGAACT

TTCTATGATGCAAAATCTATTG ATGAATTTCCTGAAATAAACCGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATGAGGACTTTTACAA AGT

GGTGGTGCAGAATGAGAGAAGGGAAGAGTGGACTTCACTCCTCGTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGGTGCGACTGGAACAGGCA

G GGGGCTTTCCTCAAGGAGACAATTCTACCTCAGCACAAGGAAACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTTGACAAGCACTACATCAA

CCGAAACTTTGACCGAACTGGGCAGATGTCTGTGGTGATCACGCCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGATCTTGACCAAGCAGCGG

ATGATTGATAATG GAATTGGTGTGGACTTAGTGTGCATGGGAGAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACATAACCGGAGTGTTCCGAG

GGATTCTCGACTGGGTGATGATTATAATATTCCTCACTGGATAAACCATAG - UNI36249 - TTTCTACACATCCAAAAGCCAGCTCTTTTGTAACA

GTTTCACTCCACGGATAAAACTAGCAGGAAAGAAG TCTGCCTCTGAGAAAACCAAAAATGGTCGTGATACAT - UNI15866 - CTCTCGGGACTCC

AAAGGAATCTGAAAACACCCTTCCCATCCAAGTAGATTATGATGCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCCGGGCTCAGCGCCTCGCC

ACCTGCAG GTCTGTGAGAGAACAGGAGAATCACAGTCGCAAAAGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGCCAAGCCGTGCACTGCCC

ACTGAGGAAGTGAGGAGCCAGGCTTCTGATGACAGCTCCCTGGGCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCTGCACCAGTATGAAGTCA

GCAGCTCACTGGGCTACACCAGCACCCGAG - UNI20448 - ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACTCCAGTGCACCAGGAAGG

TTCCATGTGGGTAGTGCAGAGTCCATGCTCCATGTCCGACCTGGAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGCCCCCTCGAGGATGCCCA

TGAAGCTCACCTCCAACAGAAGGCGCTGGATGCACACTTTTCCTGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCCAGATCCATCATCAGACC

CGGCAAAACATGGCAGAGCTGCAGGGCAGCAGGCAGAGGGACCCTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCATGAAGCTGCCGGGAG G

CACAGCACTTCCCGCCAGCCTGGTGACAGCATGTCCTTGAACTTCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAACAGCAGTACAG GTGTG

AATCCTAGGACCCAGAACAAGGACTCCCTAGAGGACAGTGTTTCTACCTCTCCAGACCCAA TGCCAGGCTTCTGTTGCACAGTTGGAGTGGATTGGAAG

TCTCTTACTACTCCTGCATGCCTTCCCCTCACCACTGACTACTTCCCGGACCGTCAGGGCCTGCAGAATGACTACACAGAGGGCTGCTATGATCTCCTCC

CAGAAGCAGACATGGACAG GAGGGATGAGGAGGGTGTTCAAATGACAGCCCAGCAAGTGTTTGAAGAGTTCATCTGCCAGCGTCTCATGCAGGGTTACC

AAATCATAGTACAGCCAAAGACCCAGAAACCCAACACCACAGTCCCACCCCCATTGAGCAGTAGCCCACTCTATAGCAGAG GCCTTGTGTCCCGAAATC

GCCCTGAGGAGGAAGGCCAGTATTGGTTAAGTATGGGCAGAACTTTCCATAAGGTGACACTCAAGGACAAGATGATCACAGTAACTCGTTACCTTCCCAA

 GTACCCTTATGAATCTGCCCAGATCCATTACACCTACAGCCTCTGCCCTTCCCACTCTGACTCGGAGTTTGTCTCCTGTTGGGTGGATTTCTGCCACGA

ACGGCTCGAGGAATACAAGTGGAATTACTTAGATCAGTATATTTGTTCTGCTGGCTCTGAAGACTTCAG CTTAATCGAGTCTCTGAAGTTCTGGAGAAC

CCGATTTTTACTACTGCCAGCCTGTGTTACTGCCACCAAGCGCATCACAGAAGGGGAGGTGCACTGTGACATCTATGGGGACAAACCCCGTGCAGATGAA

GATGAGTGGCAGCTTCTAGATGGCTTTATTCGCTTTGTAGAGGGCTTAAATCGCATCCGCAGGCGCCACCGCTCAGACCGCATGATTCGG - UNI3440

 - AAGGGGACTGCCATGAAAGGCTTGCAGATGACCGGGCCCATCTCTGCACACTCTCTCGAGGCAGCAGGCCCTCCAGTCGGCAAGAAAGGAACCTCAG

CTCTGTCTGCCCTGCTGGAGATGGAAGCTAGTCAGAA - UNI30938 - GAGCCTAGGAGAACAGCAGACGACTGTGCACGGAAAAAGCTCCACTCAG

CCAGCTGAGAACAGCAGTGTTGCCATGACTCCCACCTATGTGGACAGCCCACGCAAG GACGGGGCCTTCTTTATGGAGTTTGTCCGCAGCCCACGCACA

GCATCATCTGCCTTCTACCCTCAG - UNI23215 - GCATCTGTGGACCAAACAGCTCCTCTGGTGTTAGACAGCACCAGTTTAGGGGTCAGCACAGG

CCAGCCCATGGATAGAGGCAACAACCAGACCTTTGGGAACTCCCAGAACATAGAACAGGCCTTTCCCTCTGCAAACTCTGGTGACTACAG - UNI2516

8 - CTCTCAGCAGCATGTAGCAAGCTCTCTAACATCGTCTTCTACCCTGGTGGAGATTCTGGAAGCCATGAAGCATCCCTC - UNI29245 - GACA

GGAGTCCAGCTGCTGTCTGAACAGAAGGGCCTTTCACCGTGCTGCTTCATCAGTGCTGAGGTCGTACACTGGTTGATGAACAACGTGGAGGGGGTCCAGA

CGCAGGCGATGGGCATAGACATCATGCAG AAAATGCTGGAAGAGCAGCTCATAACGCATGCATCTGGTGAAGCATGGCGGACCTTCATCTATGGCTTCT

ATTTCTACAAGATAGTAATGGACAAAGAACCGGAAAGAG TGGCTATGCAGCAGCCCTCTGCCCCCTGGTACACAGCAGGAGCGGATGACTTTGCCAGCT

TCCAACGCAAGTGGTTTGAGGTGGCCTTTGTGGCAGAAGAGCTTGTGCACTCTGAGATTCCTGCCTTCCTCCTGCCCTGGCTACCTAGCCGGCCAGCCTC

TTATGCAAGCAGACACAGCTCCTTTAGCCGAAGTTTTGGAGGACGGAGCCAGGCAGCTGCGCTGTTAG - UNI10017 - CTGCTACTGTCCCAGAGC

AGAGGACTGTGACCCTGGATGTTGATGTGAACAACCGAACGGACCGGCTGGAATGGTGCAGCTGTTACTACCATGGAAACTTCTCTCTCAATGCCGCCTT

TGAGATCAAGCTACACTGGATGGCAGTGACTGCCACAGTGCTGTTTGAGATG - UNI36772 - GTCCAAGGTTGGCATCGAAAAGCTACCTCCTGTG

GCTTCTTGCTGGTCCCAGTTTTGGAGGGTCCTTTTGCTCTGCCCAGTTACCTGTATGGTGATCCCCTGAGGGCCCAGCTCTTCATCCCGCTCAACCTCAG

CTGCTTGCTCAAGGAGGGCAGCGAGCACCTGTTCGATA GCTTTGAACCAGAGACATATTGGGATCGAATGCATCTTTTCCAGGAAGCCATTGCACACAG

 GTTTGGATTTGTGCAAGATAAATATTCTGTCTCCGCTTTTAACTTCCCTGCTGAGAATAAGCCACAGTATATCCATGTCACAG GAACGGTGTTCCTTC

AGCTGCCGTACTCCAAACGCAAGTTTTCAGGGCAGCAGCGGCGGCGACGGAACTCTACCAGCTCCACCAACCAAAACATGTTCTGTGAGGAGCGGGTTGG

CTACAACTGGGCCTACAACACCATGCTGACCAAGACATGGCGCTCTAGTGCCACAGGGGACGAGAAGTTTGCTGATCGGCTGCTGAAGGACTTCACGGAT

TTCTGCATCAACCGTGACAACCGACTGGTCACGTTCTGGACAAACTGCCTGGAGAAGATGCATGCCAGTGCTCCATGAAGCCAGGCTGCTTCTCTTAAGA

GAGGCTGTGGGTATGCTGGAGCTGGCCTTCCGGTCAGGCTCTGGGCAGCAGGTGTCAGGCTGCTCCTATCAGTGAGTGGGGCCACTGCTGATATTTGGCC

TCTGCACAAGTGTGAGTGAAGAGAAAGATTGGAAGCAGCTGCTGCCGCTACCGCCAACCAAATCTTGCCAATCCTGTCCCTGAAGCAGGGGGAGGCACAG

ATTGTCCGTGGGAGTGAGTCAGTGTCTGGGAGTGGGGTAGGCAGCTTCCATTAGGGTCCTTTTCCTTCACCAGCAGTGGGATATTCGGAACAGAACCTCC

TGCTTTCTGCCCAAGAGTGTGTGTATGAGGTAAATCTGTGGCATAATGTACCATTGGCTCACACCAGCTGTACATATGTGTACATAGCAGAATCTAATAA

AGCCCTCCCTCCCTC
Translation
 - UNI17119 - - UNI23271 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHPN

DEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFKDQYIGRGDMWRLKKSL VSTCAYITQKVEFAGIR 

RAQAGELWVKNEKVMCGYISEETR VVFRSTSAMVYIFIQMSCEMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVVL

FSRTFYDAKSID DEFPEINRASIQEDHKGRFYEDFYK KVVVQNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLSF

NV VFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQRMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS - 

UNI36249 - SFYTSKSQLFCNSFTPRIKLAGKK SASEKTKNGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQRL

ATCR RSVREQENHSRKSASSCDVSSSPSLPSRALPTEEVRSQASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLENM

IEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQGS

RQRDPTHSSAELLELAYHEAAGR RHSTSRQPGDSMSLNFSGTEELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPM MPGFCCTVGVDWKSLTTP

ACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDR RRDEEGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRG GLVSRNRP

EEEGQYWLSMGRTFHKVTLKDKMITVTRYLPK KYPYESAQIHYTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS SLIESLKFW

RTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDGFIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTGPISAHSLEAA

GPPVGKKGTSALSALLEMEASQK - UNI30938 - KSLGEQQTTVHGKSSTQPAENSSVAMTPTYVDSPRK DGAFFMEFVRSPRTASSAFYPQ - U

NI23215 - ASVDQTAPLVLDSTSLGVSTGQPMDRGNNQTFGNSQNIEQAFPSANSGDYS - UNI25168 - SSQQHVASSLTSSSTLVEILEAMKH

PS - UNI29245 - STGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQ KMLEEQLITHASGEAWRTFIYGFYFYKIVMDKEPERV 

VAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSFSRSFGGRSQAAALLA - UNI10017 - AATVPEQRT

VTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEM - UNI36772 - VQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQL

FIPLNLSCLLKEGSEHLFDS SFEPETYWDRMHLFQEAIAHR RFGFVQDKYSVSAFNFPAENKPQYIHVTG GTVFLQLPYSKRKFSGQQRRRRNSTSS

TNQNMFCEERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTNCLEKMHASAP
Transcript ENSMUST00000046788
Sequence
CCTCGGGAGCGGCGCGGGCTCAGGTGAGCGCTCTTCGGTGGTGCTGTCTGTCTGGTTCCTAGAGCCCTGGTGCGGAAGCTGCGCGAACTGTGGGGGCTCA

G - UNI23271 - TTCCCCGTGTGACCTTGGACCAGTCTTTCTCTCACCAAGCTTCCCGGACCGCAGCGGTGAAATGGAGGCAGGACGGTCCGCTGAG

AGTTGGTACCAGTAGAGGGGTCGGCAAGGAAACCGCAGCCTTCCTCAGTTCTCTTTTCCCCAGGACATTGTTAGTGGACCGCGAGTCATGGGAGTGCATA

ACAGTTCGAGTGACCTTGGGCGAATCCCTTGTTTTGACGTTCCTCTACTTATGTGATGGACTAACCTCTTCGAATATCCCTGTACTATTTTGGTGTTCCT

GATGCAGACAAAAACAAG - UNI17119 - TAGCAGGAAAGCAAGATGACTTCCCTGCTCCAAGATTGGAACAGCTGAAGAAATCACAAGACAAAATG

AGAACCACAAAGGTCTACAAACTTGTCATCCACAAGAAGGGCTTTGGGGGCAGTG - UNI17119 - - UNI18643 - ATGATGAGCTAGTCGTGA

ACCCTAAAGTATTTCCTCACATCAAACTTGGAGACATTGTGGAGATTGCTCACCCCAATGATGAGTACAG TCCTTTGCTTTTGCAAGTCAAGTCGCTTA

AGGAAGATTTACAGAAAG AAACTATCAGTGTGGACCAGACTGTGACTCAAGTATTCCGGCTAAGACCTTATCAAGATGTCTATGTGAATGTTGTAGACC

CCAAG GATGTGACTCTTGACCTGGTGGAATTGACTTTTAAG CTGTGCCTATATCACTCAAAAAGTGGAATTTGCTGGCATCAG GTGGTGTTCCGTTC

TACGTCGGCTATGGTTTACATATTTATTCAGATGAGCTGTGAAATGTGGGATTTTGATATTTATG - UNI27595 - GGGATCTGTACTTTGAGAAAG

CTGTGAACGGTTTCCTCGCCGACCTGTTTACTAAATGGAAG GAGAAGAACTGTAGTCATGAAGTGACTGTGGTCCTGTTTTCCAGAACTTTCTATGATG

CAAAATCTATTG ATGAATTTCCTGAAATAAACCGAGCTTCAATTCAAGAGGATCACAAAGGGAGATTCTATGAGGACTTTTACAA AGTGGTGGTGCAG

AATGAGAGAAGGGAAGAGTGGACTTCACTCCTCGTGACCATTAAAAAACTCTTCATCCAGTATCCAGTGTTGGTGCGACTGGAACAGGCAG GGGGCTTT

CCTCAAGGAGACAATTCTACCTCAGCACAAGGAAACTACCTAGAGGCCATCAACTTGTCATTCAATG TGTTTGACAAGCACTACATCAACCGAAACTTT

GACCGAACTGGGCAGATGTCTGTGGTGATCACGCCGGGGGTGGGTGTCTTTGAAGTGGACCGCCTACTCATGATCTTGACCAAGCAGCGGATGATTGATA

ATG GAATTGGTGTGGACTTAGTGTGCATGGGAGAGCAGCCACTACATGCTGTGCCATTATTCAAG CTACATAACCGGAGTGTTCCGAGGGATTCTCGA

CTGGGTGATGATTATAATATTCCTCACTGGATAAACCATAG - UNI36249 - TTTCTACACATCCAAAAGCCAGCTCTTTTGTAACAGTTTCACTCC

ACGGATAAAACTAGCAGGAAAGAAG TCTGCCTCTGAGAAAACCAAAAATGGTCGTGATACAT - UNI15866 - CTCTCGGGACTCCAAAGGAATCT

GAAAACACCCTTCCCATCCAAGTAGATTATGATGCCTACGATGCTCAAGTGTTCAGGCTGCCTGGCCCATCCCGGGCTCAGCGCCTCGCCACCTGCAG G

TCTGTGAGAGAACAGGAGAATCACAGTCGCAAAAGTGCAAGCTCCTGTGATGTCTCATCCAGCCCTTCCCTGCCAAGCCGTGCACTGCCCACTGAGGAAG

TGAGGAGCCAGGCTTCTGATGACAGCTCCCTGGGCAAGAGCACCAACATCCTGATGATCCCTAACCCCCACCTGCACCAGTATGAAGTCAGCAGCTCACT

GGGCTACACCAGCACCCGAG - UNI20448 - ATGTCCTGGAGAACATGATAGAACCCCCACAGAGGGACTCCAGTGCACCAGGAAGGTTCCATGTGG

GTAGTGCAGAGTCCATGCTCCATGTCCGACCTGGAGGATACACGCCTCAGAGAGCGCTGATTAACCCCTTCGCCCCCTCGAGGATGCCCATGAAGCTCAC

CTCCAACAGAAGGCGCTGGATGCACACTTTTCCTGTAG - UNI25192 - GCCCATCTGGAGAGGCCATCCAGATCCATCATCAGACCCGGCAAAACA

TGGCAGAGCTGCAGGGCAGCAGGCAGAGGGACCCTACCCACTCCTCTGCAGAGCTGTTGGAGTTGGCATACCATGAAGCTGCCGGGAG GCACAGCACTT

CCCGCCAGCCTGGTGACAGCATGTCCTTGAACTTCAGTGGAACGGAAGAGCTTTCTGTCAGCCTGCTTAGCAACAGCAGTACAG GTGTGAATCCTAGGA

CCCAGAACAAGGACTCCCTAGAGGACAGTGTTTCTACCTCTCCAGACCCAA TGCCAGGCTTCTGTTGCACAGTTGGAGTGGATTGGAAGTCTCTTACTA

CTCCTGCATGCCTTCCCCTCACCACTGACTACTTCCCGGACCGTCAGGGCCTGCAGAATGACTACACAGAGGGCTGCTATGATCTCCTCCCAGAAGCAGA

CATGGACAG GAGGGATGAGGAGGGTGTTCAAATGACAGCCCAGCAAGTGTTTGAAGAGTTCATCTGCCAGCGTCTCATGCAGGGTTACCAAATCATAGT

ACAGCCAAAGACCCAGAAACCCAACACCACAGTCCCACCCCCATTGAGCAGTAGCCCACTCTATAGCAGAG GCCTTGTGTCCCGAAATCGCCCTGAGGA

GGAAGGCCAGTATTGGTTAAGTATGGGCAGAACTTTCCATAAGGTGACACTCAAGGACAAGATGATCACAGTAACTCGTTACCTTCCCAA GTACCCTTA

TGAATCTGCCCAGATCCATTACACCTACAGCCTCTGCCCTTCCCACTCTGACTCGGAGTTTGTCTCCTGTTGGGTGGATTTCTGCCACGAACGGCTCGAG

GAATACAAGTGGAATTACTTAGATCAGTATATTTGTTCTGCTGGCTCTGAAGACTTCAG CTTAATCGAGTCTCTGAAGTTCTGGAGAACCCGATTTTTA

CTACTGCCAGCCTGTGTTACTGCCACCAAGCGCATCACAGAAGGGGAGGTGCACTGTGACATCTATGGGGACAAACCCCGTGCAGATGAAGATGAGTGGC

AGCTTCTAGATGGCTTTATTCGCTTTGTAGAGGGCTTAAATCGCATCCGCAGGCGCCACCGCTCAGACCGCATGATTCGG - UNI3440 - AAGGGGA

CTGCCATGAAAGGCTTGCAGATGACCGGGCCCATCTCTGCACACTCTCTCGAGGCAGCAGGCCCTCCAGTCGGCAAGAAAGGAACCTCAGCTCTGTCTGC

CCTGCTGGAGATGGAAGCTAGTCAGAA - UNI30938 - GAGCCTAGGAGAACAGCAGACGACTGTGCACGGAAAAAGCTCCACTCAGCCAGCTGAGA

ACAGCAGTGTTGCCATGACTCCCACCTATGTGGACAGCCCACGCAAG - UNI23215 - GCATCTGTGGACCAAACAGCTCCTCTGGTGTTAGACAGC

ACCAGTTTAGGGGTCAGCACAGGCCAGCCCATGGATAGAGGCAACAACCAGACCTTTGGGAACTCCCAGAACATAGAACAGGCCTTTCCCTCTGCAAACT

CTGGTGACTACAG - UNI25168 - CTCTCAGCAGCATGTAGCAAGCTCTCTAACATCGTCTTCTACCCTGGTGGAGATTCTGGAAGCCATGAAGCAT

CCCTC - UNI29245 - GACAGGAGTCCAGCTGCTGTCTGAACAGAAGGGCCTTTCACCGTGCTGCTTCATCAGTGCTGAGGTCGTACACTGGTTGAT

GAACAACGTGGAGGGGGTCCAGACGCAGGCGATGGGCATAGACATCATGCAG AAAATGCTGGAAGAGCAGCTCATAACGCATGCATCTGGTGAAGCATG

GCGGACCTTCATCTATGGCTTCTATTTCTACAAGATAGTAATGGACAAAGAACCGGAAAGAG TGGCTATGCAGCAGCCCTCTGCCCCCTGGTACACAGC

AGGAGCGGATGACTTTGCCAGCTTCCAACGCAAGTGGTTTGAGGTGGCCTTTGTGGCAGAAGAGCTTGTGCACTCTGAGATTCCTGCCTTCCTCCTGCCC

TGGCTACCTAGCCGGCCAGCCTCTTATGCAAGCAGACACAGCTCCTTTAGCCGAAGTTTTGGAGGACGGAGCCAGGCAGCTGCGCTGTTAG - UNI100

17 - CTGCTACTGTCCCAGAGCAGAGGACTGTGACCCTGGATGTTGATGTGAACAACCGAACGGACCGGCTGGAATGGTGCAGCTGTTACTACCATGGA

AACTTCTCTCTCAATGCCGCCTTTGAGATCAAGCTACACTGGATGGCAGTGACTGCCACAGTGCTGTTTGAGATG - UNI36772 - GTCCAAGGTTG

GCATCGAAAAGCTACCTCCTGTGGCTTCTTGCTGGTCCCAGTTTTGGAGGGTCCTTTTGCTCTGCCCAGTTACCTGTATGGTGATCCCCTGAGGGCCCAG

CTCTTCATCCCGCTCAACCTCAGCTGCTTGCTCAAGGAGGGCAGCGAGCACCTGTTCGATA GCTTTGAACCAGAGACATATTGGGATCGAATGCATCTT

TTCCAGGAAGCCATTGCACACAG GTTTGGATTTGTGCAAGATAAATATTCTGTCTCCGCTTTTAACTTCCCTGCTGAGAATAAGCCACAGTATATCCAT

GTCACAG GAACGGTGTTCCTTCAGCTGCCGTACTCCAAACGCAAGTTTTCAGGGCAGCAGCGGCGGCGACGGAACTCTACCAGCTCCACCAACCAAAAC

ATGTTCTGTGAGGAGCGGGTTGGCTACAACTGGGCCTACAACACCATGCTGACCAAGACATGGCGCTCTAGTGCCACAGGGGACGAGAAGTTTGCTGATC

GGCTGCTGAAGGACTTCACGGATTTCTGCATCAACCGTGACAACCGACTGGTCACGTTCTGGACAAACTGCCTGGAGAAGATGCATGCCAGTGCTCCATG

AAGCCAGGCTGCTTCTCTTAAGAGAGGCTGTGGGTATGCTGGAGCTGGCCTTCCGGTCAGGCTCTGGGCAGCAGGTGTCAGGCTGCTCCTATCAGTGAGT

GGGGCCACTGCTGATATTTGGCCTCTGCACAAGTGTGAGTGAAGAGAAAGATTGGAAGCAGCTGCTGCCGCTACCGCCAACCAAATCTTGCCAATCCTGT

CCCTGAAGCAGGGGGAGGCACAGATTGTCCGTGGGAGTGAGTCAGTGTCTGGGAGTGGGGTAGGCAGCTTCCATTAGGGTCCTTTTCCTTCACCAGCAGT

GGGATATTCGGAACAGAACCTCCTGCTTTC
Translation
 - UNI23271 -  - UNI17119 - MRTTKVYKLVIHKKGFGGSD - UNI17119 - - UNI18643 - DDELVVNPKVFPHIKLGDIVEIAHP

NDEYS SPLLLQVKSLKEDLQKE ETISVDQTVTQVFRLRPYQDVYVNVVDPK DVTLDLVELTFK LCLYHSKSGICWHQ VVFRSTSAMVYIFIQMSC

EMWDFDIYG - UNI27595 - GDLYFEKAVNGFLADLFTKWK EKNCSHEVTVVLFSRTFYDAKSID DEFPEINRASIQEDHKGRFYEDFYK KVVV

QNERREEWTSLLVTIKKLFIQYPVLVRLEQAG GGFPQGDNSTSAQGNYLEAINLSFNV VFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLMILTKQ

RMIDNG GIGVDLVCMGEQPLHAVPLFK LHNRSVPRDSRLGDDYNIPHWINHS - UNI36249 - SFYTSKSQLFCNSFTPRIKLAGKK SASEKTK

NGRDTS - UNI15866 - SLGTPKESENTLPIQVDYDAYDAQVFRLPGPSRAQRLATCR RSVREQENHSRKSASSCDVSSSPSLPSRALPTEEVRSQ

ASDDSSLGKSTNILMIPNPHLHQYEVSSSLGYTSTRD - UNI20448 - DVLENMIEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPS

RMPMKLTSNRRRWMHTFPVG - UNI25192 - GPSGEAIQIHHQTRQNMAELQGSRQRDPTHSSAELLELAYHEAAGR RHSTSRQPGDSMSLNFSGT

EELSVSLLSNSSTG GVNPRTQNKDSLEDSVSTSPDPM MPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDYTEGCYDLLPEADMDR RRDEEGV

QMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNTTVPPPLSSSPLYSRG GLVSRNRPEEEGQYWLSMGRTFHKVTLKDKMITVTRYLPK KYPYESAQIH

YTYSLCPSHSDSEFVSCWVDFCHERLEEYKWNYLDQYICSAGSEDFS SLIESLKFWRTRFLLLPACVTATKRITEGEVHCDIYGDKPRADEDEWQLLDG

FIRFVEGLNRIRRRHRSDRMIR - UNI3440 - KGTAMKGLQMTGPISAHSLEAAGPPVGKKGTSALSALLEMEASQK - UNI30938 - KSLGEQ

QTTVHGKSSTQPAENSSVAMTPTYVDSPRK - UNI23215 - ASVDQTAPLVLDSTSLGVSTGQPMDRGNNQTFGNSQNIEQAFPSANSGDYS - UN

I25168 - SSQQHVASSLTSSSTLVEILEAMKHPS - UNI29245 - STGVQLLSEQKGLSPCCFISAEVVHWLMNNVEGVQTQAMGIDIMQ KMLE

EQLITHASGEAWRTFIYGFYFYKIVMDKEPERV VAMQQPSAPWYTAGADDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSFSRSF

GGRSQAAALLA - UNI10017 - AATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTATVLFEM - UNI36772 - VQGW

HRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNLSCLLKEGSEHLFDS SFEPETYWDRMHLFQEAIAHR RFGFVQDKYSVSAFNFPAENKPQ

YIHVTG GTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFCEERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTNCLEKMH

ASAP

For any suggestions or comments, please send an email to unitrap@crg.es