Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037437 (Adam32)
Chromosomal location
Chr 8: 25946616 - 26059273 (-)
Description
a disintegrin and metallopeptidase domain 32 Gene [Source:MGI (curated);Acc:Adam32-001]
RefSeq_dna
NM_153397 
RefSeq_peptide
NP_700446.1 
UniGene
Mm.269223 
MGI
MGI:2653822 
Uniprot/SWISSPROT
Q8K410 
Human Ortholog
ENSG00000197140 (ADAM32)
Omim not available
UniTrap UNI32373
Vector Insertion
Chr 8: 26031759 - 26032808
Public Clones IST12410A12 (tigm) IST12000A8 (tigm) IST12622C3 (tigm) IST12589A4 (tigm)
IST12522A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34176
Vector Insertion
Chr 8: 26030381 - 26031837
Public Clones IST12000A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32514
Vector Insertion
Chr 8: 26011913 - 26013357
Public Clones IST11295D1 (tigm) IST11294H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36459
Vector Insertion
Chr 8: 25962648 - 25974018
Public Clones IST14257E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33813
Vector Insertion
Chr 8: 25948254 - 25962098
Public Clones IST10321G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28499
Vector Insertion
Chr 8: 25946617 - 25946792
Public Clones not available
Private Clones OST29514 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110649
Sequence
GACGCCATGCTGGGCGCCATGCTGCACACACTGCTGCTGCTGCTGCTGGCCGAGCTGGGGGCCTTGCTGGCATCAGGACCCG AGTCTCAAAGTTCATTT

CTAGAAATCATATTTCCAGAGAAAATTGAAGATAAAACACACTCAGAA GAACAGATATCCTATATTATTCCAATAAACAAGAAGCAGTACACTGTGCAC

CTCCAGAAAAG - UNI32373 - ATATTTTTTAACGAATCGTTTTATGGTTTATATGTATAATCAAGGATCTACAAGTTTTCATTCTCCAAACATTCC

G - UNI32373 - - UNI34176 - GCTCAGTGCTATTATCAAGGACACATCAAAGGCTACCCGAACTCAGTCGCCACCCTCAGCACATGCTCTGGA

CTGAG - UNI32373 - - UNI34176 - AGGGTTCCTGCAGTTTGAGAATGTGTCCTACGGAATTGAGCCTCTGCAATCTGCATTTACATCTCAAC

ACATTGTTTATAAGCTAGGGAACAAAGAGAAGGAGTTGATATTTAACAAAAACAGCAGAAACATAGAGATGCCTACAAACTATGGCATTTTAATCAACAA

AAAG - UNI34176 - CCAAAATCACCTTTTAAAAACTTGTTTCCCCTCTATCTAGAGATGAGTATTGTGGTGGACAAAGCGCTG TATGATTACTTG

GGCTCTGACAGCAATATTGTAACAAATAAAATCATTGAAATTATCAGTCTTATAAATTCA GTGTTTGCCCAACTCAAGGTTACTATCGTGTTGTCCTCA

TTGGAGTTGTGGTCAGATAAGAATAAGATTCCTACAGTTGGTGAAGCAGATGAATTATTGCATAAATTTCTAGAATGGAAGCAGGCCTACCTTACCCTAA

GACCTCATGATGTTGCATATCTATTCAT - UNI32513 - TTATAACGAGTACCCAAATTACATGGGAGCAACGTATCCTGGGAAGATGTGTACTGCC

CACTACTCTGCAGGAATCACAATG - UNI32513 - TACCCCAAGGATATGACCTTGGAGGCCTTTTCGGTTATTCTCACCCAAATGCTGGGGCTCAG

TCTGGGGATATCGTATGATGAGCCTGAGAAATGCTACTGCTCGGAATCCATCTGCATCATGAATCCCAGGGCGAT - UNI32513 - GCAATATGGAG

GTGTGAAGTCATTTAGCAATTGCAGTTTGAATGACTTTGAACATTTTAAATCGAACGAGGGTGCCAAATGTCTGCAGAATAAGCCACAGATGCAAAGGAC

TGCAGCAGCGGTCTGCGGAAATGGCAAGGTGGAGGGTGATGAAATTTGTGACTGTGGCTCTGAAGCA GAATGTGGGCCTGATAGCTGTTGTGAACCTAA

CAGATGTGTTCTGAAAGCAGGAAGAGCTTGTGACAGTAAGTCTCCCTCATCAACATGCTGCAAAAATTGTCAA TTTTTACCAGAAAAACATCAATGTAG

GCCGGAAAAGCATCTATACTGTGACATTCCTGAAGTCTGCAATGGGAGCTCAGGAAATTGTCCACCTGATGTAACTATAAACAATGGGCATGTTTGCAAA

GAAAGCGGGACTATCTGTTATAATGGAGACTGTCCGGACCTGGACAGGGTGTGCGAGTCAATATATGGAGCAG GTTCAGTGAATGCTCCATTTGCCTGC

TATGAAGAAATCCAGGGCCAAAATGATAGGTTTGGCAACTGTGGCAAAGACAACCGAAACAGATATGTGTTCTGTGGATGGAG GAATCTCATATGTGGG

AGATTGATTTGTACGTACCCTACCCGAATGCCTTACAACCCACCCAATAACAGTACAGCTTCTGTGATCTATGCTTTTGTGCGAGACAAAGTGTGTATAA

CTGTGGACTTTGGATCGAGTGTCAAAGAAGATCCACTCAGGGTTGCTAATGGTGCTACATGTGATCTTGATAGG ATCTGCTTAAATGGCGTGTGCGTAG

AATCGAGATTTCTTAGGGATCAATCAAAAACGTGTTCATCCAAGTGCCACGGGAACGGA - UNI36459 - AAGCAAATCAGAAGACAGCACTTACAC

GTATGTCAGCAGGTGAGTTCATTAAAAGACGGTGTGAAGAGACATGTTGAAAATGAACATCATAACTTTCAGCCG - UNI33813 - - UNI36459 

- ATTGTTTTT
Translation
MLGAMLHTLLLLLLAELGALLASGPE ESQSSFLEIIFPEKIEDKTHSE EQISYIIPINKKQYTVHLQKR - UNI32373 - RYFLTNRFMVYMYNQ

GSTSFHSPNIP - UNI32373 - - UNI34176 - AQCYYQGHIKGYPNSVATLSTCSGLR - UNI32373 - - UNI34176 - RGFLQFENV

SYGIEPLQSAFTSQHIVYKLGNKEKELIFNKNSRNIEMPTNYGILINKK - UNI34176 - PKSPFKNLFPLYLEMSIVVDKAL YDYLGSDSNIVTN

KIIEIISLINS VFAQLKVTIVLSSLELWSDKNKIPTVGEADELLHKFLEWKQAYLTLRPHDVAYLFI - UNI32513 - IYNEYPNYMGATYPGKMC

TAHYSAGITM - UNI32513 - YPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAM - UNI32513 - MQYGGVKSFSNCSLND

FEHFKSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEICDCGSEA ECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQ FLPEKHQCRPEKHLYCDIP

EVCNGSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDRVCESIYGAG GSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWR RNLICGRLICTYP

TRMPYNPPNNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVANGATCDLDR ICLNGVCVESRFLRDQSKTCSSKCHGNG - UNI36459 - KQIRRQ

HLHVCQQVSSLKDGVKRHVENEHHNFQP - UNI33813 - - UNI36459 - IVF
Transcript ENSMUST00000119720
Sequence
ATGCTGGGCGCCATGCTGCACACACTGCTGCTGCTGCTGCTGGCCGAGCTGGGGGCCTTGCTGGCATCAGGACCCG AGTCTCAAAGTTCATTTCTAGAA

ATCATATTTCCAGAGAAAATTGAAGATAAAACACACTCAGAA GAACAGATATCCTATATTATTCCAATAAACAAGAAGCAGTACACTGTGCACCTCCAG

AAAAG - UNI32373 - ATATTTTTTAACGAATCGTTTTATGGTTTATATGTATAATCAAGGATCTACAAGTTTTCATTCTCCAAACATTCCG - UN

I32373 - - UNI34176 - GCTCAGTGCTATTATCAAGGACACATCAAAGGCTACCCGAACTCAGTCGCCACCCTCAGCACATGCTCTGGACTGAG 

- UNI32373 - - UNI34176 - AGGGTTCCTGCAGTTTGAGAATGTGTCCTACGGAATTGAGCCTCTGCAATCTGCATTTACATCTCAACACATTG

TTTATAAGCTAGGGAACAAAGAGAAGGAGTTGATATTTAACAAAAACAGCAGAAACATAGAGATGCCTACAAACTATGGCATTTTAATCAACAAAAAG -

 UNI34176 - CCAAAATCACCTTTTAAAAACTTGTTTCCCCTCTATCTAGAGATGAGTATTGTGGTGGACAAAGCGCTG TATGATTACTTGGGCTCT

GACAGCAATATTGTAACAAATAAAATCATTGAAATTATCAGTCTTATAAATTCA GTGTTTGCCCAACTCAAGGTTACTATCGTGTTGTCCTCATTGGAG

TTGTGGTCAGATAAGAATAAGATTCCTACAGTTGGTGAAGCAGATGAATTATTGCATAAATTTCTAGAATGGAAGCAGGCCTACCTTACCCTAAGACCTC

ATGATGTTGCATATCTATTCAT - UNI32513 - TTATAACGAGTACCCAAATTACATGGGAGCAACGTATCCTGGGAAGATGTGTACTGCCCACTAC

TCTGCAGGAATCACAATG - UNI32513 - TACCCCAAGGATATGACCTTGGAGGCCTTTTCGGTTATTCTCACCCAAATGCTGGGGCTCAGTCTGGG

GATATCGTATGATGAGCCTGAGAAATGCTACTGCTCGGAATCCATCTGCATCATGAATCCCAGGGCGAT - UNI32513 - GCAATATGGAGGTGTGA

AGTCATTTAGCAATTGCAGTTTGAATGACTTTGAACATTTTAAATCGAACGAGGGTGCCAAATGTCTGCAGAATAAGCCACAGATGCAAAGGACTGCAGC

AGCGGTCTGCGGAAATGGCAAGGTGGAGGGTGATGAAATTTGTGACTGTGGCTCTGAAGCA GAATGTGGGCCTGATAGCTGTTGTGAACCTAACAGATG

TGTTCTGAAAGCAGGAAGAGCTTGTGACAGTAAGTCTCCCTCATCAACATGCTGCAAAAATTGTCAA TTTTTACCAGAAAAACATCAATGTAGGCCGGA

AAAGCATCTATACTGTGACATTCCTGAAGTCTGCAATGGGAGCTCAGGAAATTGTCCACCTGATGTAACTATAAACAATGGGCATGTTTGCAAAGAAAGC

GGGACTATCTGTTATAATGGAGACTGTCCGGACCTGGACAGGGTGTGCGAGTCAATATATGGAGCAG GTTCAGTGAATGCTCCATTTGCCTGCTATGAA

GAAATCCAGGGCCAAAATGATAGGTTTGGCAACTGTGGCAAAGACAACCGAAACAGATATGTGTTCTGTGGATGGAG GAATCTCATATGTGGGAGATTG

ATTTGTACGTACCCTACCCGAATGCCTTACAACCCACCCAATAACAGTACAGCTTCTGTGATCTATGCTTTTGTGCGAGACAAAGTGTGTATAACTGTGG

ACTTTGGATCGAGTGTCAAAGAAGATCCACTCAGGGTTGCTAATGGTGCTACATGTGATCTTGATAGG ATCTGCTTAAATGGCGTGTGCGTAGAATCGA

GATTTCTTAGGGATCAATCAAAAACGTGTTCATCCAAGTGCCACGGGAACGGA - UNI36459 - AAGCAAATCAGAAGACAGCACTTACACGTATGT

CAGCAGGTGAGTTCATTAAAAGACGGTGTGAAGAGACATGTTGAAAATGAACATCATAACTTTCAGCCG - UNI33813 - - UNI36459 - ATCA

ACTTCTGAGACAAGCAGTATGACATCTACGAGCAG - UNI28499 - - UNI33813 - TTAATTGCTACCCCTTCATCATCAGCAGCAGCAGCAAC

AGGAGGAAGAGGAAGAGGAAGAAGGGGAGGAGGAGGAGGAGAAGGAAGATGGCACCCAGGGGCTCACTGAGAAATGAAGAGTCCACGTTCTTCCCTTGGT

CACAGCTAAAAGGAGCCAATAAACCAAAAGTGGACC
Translation
MLGAMLHTLLLLLLAELGALLASGPE ESQSSFLEIIFPEKIEDKTHSE EQISYIIPINKKQYTVHLQKR - UNI32373 - RYFLTNRFMVYMYNQ

GSTSFHSPNIP - UNI32373 - - UNI34176 - AQCYYQGHIKGYPNSVATLSTCSGLR - UNI32373 - - UNI34176 - RGFLQFENV

SYGIEPLQSAFTSQHIVYKLGNKEKELIFNKNSRNIEMPTNYGILINKK - UNI34176 - PKSPFKNLFPLYLEMSIVVDKAL YDYLGSDSNIVTN

KIIEIISLINS VFAQLKVTIVLSSLELWSDKNKIPTVGEADELLHKFLEWKQAYLTLRPHDVAYLFI - UNI32513 - IYNEYPNYMGATYPGKMC

TAHYSAGITM - UNI32513 - YPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAM - UNI32513 - MQYGGVKSFSNCSLND

FEHFKSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEICDCGSEA ECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQ FLPEKHQCRPEKHLYCDIP

EVCNGSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDRVCESIYGAG GSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWR RNLICGRLICTYP

TRMPYNPPNNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVANGATCDLDR ICLNGVCVESRFLRDQSKTCSSKCHGNG - UNI36459 - KQIRRQ

HLHVCQQVSSLKDGVKRHVENEHHNFQP - UNI33813 - - UNI36459 - INF - UNI28499 - - UNI33813 - 
Transcript ENSMUST00000041257
Sequence
GACGCCATGCTGGGCGCCATGCTGCACACACTGCTGCTGCTGCTGCTGGCCGAGCTGGGGGCCTTGCTGGCATCAGGACCCG AGTCTCAAAGTTCATTT

CTAGAAATCATATTTCCAGAGAAAATTGAAGATAAAACACACTCAGAA GAACAGATATCCTATATTATTCCAATAAACAAGAAGCAGTACACTGTGCAC

CTCCAGAAAAG - UNI32373 - ATATTTTTTAACGAATCGTTTTATGGTTTATATGTATAATCAAGGATCTACAAGTTTTCATTCTCCAAACATTCC

G - UNI32373 - - UNI34176 - GCTCAGTGCTATTATCAAGGACACATCAAAGGCTACCCGAACTCAGTCGCCACCCTCAGCACATGCTCTGGA

CTGAG - UNI32373 - - UNI34176 - AGGGTTCCTGCAGTTTGAGAATGTGTCCTACGGAATTGAGCCTCTGCAATCTGCATTTACATCTCAAC

ACATTGTTTATAAGCTAGGGAACAAAGAGAAGGAGTTGATATTTAACAAAAACAGCAGAAACATAGAGATGCCTACAAACTATGGCATTTTAATCAACAA

AAAG - UNI34176 - CCAAAATCACCTTTTAAAAACTTGTTTCCCCTCTATCTAGAGATGAGTATTGTGGTGGACAAAGCGCTG TATGATTACTTG

GGCTCTGACAGCAATATTGTAACAAATAAAATCATTGAAATTATCAGTCTTATAAATTCA GTGTTTGCCCAACTCAAGGTTACTATCGTGTTGTCCTCA

TTGGAGTTGTGGTCAGATAAGAATAAGATTCCTACAGTTGGTGAAGCAGATGAATTATTGCATAAATTTCTAGAATGGAAGCAGGCCTACCTTACCCTAA

GACCTCATGATGTTGCATATCTATTCAT - UNI32513 - TTATAACGAGTACCCAAATTACATGGGAGCAACGTATCCTGGGAAGATGTGTACTGCC

CACTACTCTGCAGGAATCACAATG - UNI32513 - TACCCCAAGGATATGACCTTGGAGGCCTTTTCGGTTATTCTCACCCAAATGCTGGGGCTCAG

TCTGGGGATATCGTATGATGAGCCTGAGAAATGCTACTGCTCGGAATCCATCTGCATCATGAATCCCAGGGCGAT - UNI32513 - GCAATATGGAG

GTGTGAAGTCATTTAGCAATTGCAGTTTGAATGACTTTGAACATTTTAAATCGAACGAGGGTGCCAAATGTCTGCAGAATAAGCCACAGATGCAAAGGAC

TGCAGCAGCGGTCTGCGGAAATGGCAAGGTGGAGGGTGATGAAATTTGTGACTGTGGCTCTGAAGCA GAATGTGGGCCTGATAGCTGTTGTGAACCTAA

CAGATGTGTTCTGAAAGCAGGAAGAGCTTGTGACAGTAAGTCTCCCTCATCAACATGCTGCAAAAATTGTCAA TTTTTACCAGAAAAACATCAATGTAG

GCCGGAAAAGCATCTATACTGTGACATTCCTGAAGTCTGCAATGGGAGCTCAGGAAATTGTCCACCTGATGTAACTATAAACAATGGGCATGTTTGCAAA

GAAAGCGGGACTATCTGTTATAATGGAGACTGTCCGGACCTGGACAGGGTGTGCGAGTCAATATATGGAGCAG GTTCAGTGAATGCTCCATTTGCCTGC

TATGAAGAAATCCAGGGCCAAAATGATAGGTTTGGCAACTGTGGCAAAGACAACCGAAACAGATATGTGTTCTGTGGATGGAG GAATCTCATATGTGGG

AGATTGATTTGTACGTACCCTACCCGAATGCCTTACAACCCACCCAATAACAGTACAGCTTCTGTGATCTATGCTTTTGTGCGAGACAAAGTGTGTATAA

CTGTGGACTTTGGATCGAGTGTCAAAGAAGATCCACTCAGGGTTGCTAATGGTGCTACATGTGATCTTGATAGG ATCTGCTTAAATGGCGTGTGCGTAG

AATCGAGATTTCTTAGGGATCAATCAAAAACGTGTTCATCCAAGTGCCACGGGAACGGA GTGTGCAATTCTCATGGTGTCTGCCACTGCAATGCCGGCT

ACTCACCTCCCAACTGTCAATATCCTACGACAAAAAGGTCAGCATCGCTGTGGTCTGGCAAGCACG - UNI36459 - ATCTGCCCATGGAAAGAGCA

TCTAAGAACCAAGAAAAGAAGTGGCTTTTAAGTTTGTACATTGTCTTAATTATCCTCGCTTCAGTGTTCCTCATAGGCACAGGGTGGAAAGGCTTGAAAC

AGTGCGGTTCCAAGGAAGAGGAGTCCATGAGTAGCGA - UNI36459 - AAGCAAATCAGAAGACAGCACTTACACGTATGTCAGCAG - UNI3381

3 - - UNI36459 - ATCAACTTCTGAGACAAGCAGTATGACATCTACGAGCAG - UNI28499 - - UNI33813 - TTAATTGCTACCCCTTC

ATCATCAGCAGCAGCAGCAACAGGAGGAAGAGGAAGAGGAAGAAGGGGAGGAGGAGGAGGAGAAGGAAGATGGCACCCAGGGGCTCACTGAGAAATGAAG

AGTCCACGTTCTTCCCTTGGTCACAGCTAAAAGGAGCCAATAAACCAAAAGTGGACC
Translation
MLHTLLLLLLAELGALLASGPE ESQSSFLEIIFPEKIEDKTHSE EQISYIIPINKKQYTVHLQKR - UNI32373 - RYFLTNRFMVYMYNQGSTS

FHSPNIP - UNI32373 - - UNI34176 - AQCYYQGHIKGYPNSVATLSTCSGLR - UNI32373 - - UNI34176 - RGFLQFENVSYGI

EPLQSAFTSQHIVYKLGNKEKELIFNKNSRNIEMPTNYGILINKK - UNI34176 - PKSPFKNLFPLYLEMSIVVDKAL YDYLGSDSNIVTNKIIE

IISLINS VFAQLKVTIVLSSLELWSDKNKIPTVGEADELLHKFLEWKQAYLTLRPHDVAYLFI - UNI32513 - IYNEYPNYMGATYPGKMCTAHY

SAGITM - UNI32513 - YPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAM - UNI32513 - MQYGGVKSFSNCSLNDFEHF

KSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEICDCGSEA ECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQ FLPEKHQCRPEKHLYCDIPEVCN

GSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDRVCESIYGAG GSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWR RNLICGRLICTYPTRMP

YNPPNNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVANGATCDLDR ICLNGVCVESRFLRDQSKTCSSKCHGNG VCNSHGVCHCNAGYSPPNCQYPT

TKRSASLWSGKHD - UNI36459 - DLPMERASKNQEKKWLLSLYIVLIILASVFLIGTGWKGLKQCGSKEEESMSSE - UNI36459 - ESKSED

STYTYVSR - UNI33813 - - UNI36459 - RSTSETSSMTSTSS - UNI28499 - - UNI33813 - S
Transcript ENSMUST00000121438
Sequence
GACGCCATGCTGGGCGCCATGCTGCACACACTGCTGCTGCTGCTGCTGGCCGAGCTGGGGGCCTTGCTGGCATCAGGACCCG AGTCTCAAAGTTCATTT

CTAGAAATCATATTTCCAGAGAAAATTGAAGATAAAACACACTCAGAA GAACAGATATCCTATATTATTCCAATAAACAAGAAGCAGTACACTGTGCAC

CTCCAGAAAAG - UNI32373 - ATATTTTTTAACGAATCGTTTTATGGTTTATATGTATAATCAAGGATCTACAAGTTTTCATTCTCCAAACATTCC

G - UNI32373 - - UNI34176 - GCTCAGTGCTATTATCAAGGACACATCAAAGGCTACCCGAACTCAGTCGCCACCCTCAGCACATGCTCTGGA

CTGAG - UNI32373 - - UNI34176 - AGGGTTCCTGCAGTTTGAGAATGTGTCCTACGGAATTGAGCCTCTGCAATCTGCATTTACATCTCAAC

ACATTGTTTATAAGCTAGGGAACAAAGAGAAGGAGTTGATATTTAACAAAAACAGCAGAAACATAGAGATGCCTACAAACTATGGCATTTTAATCAACAA

AAAG - UNI34176 - CCAAAATCACCTTTTAAAAACTTGTTTCCCCTCTATCTAGAGATGAGTATTGTGGTGGACAAAGCGCTG TATGATTACTTG

GGCTCTGACAGCAATATTGTAACAAATAAAATCATTGAAATTATCAGTCTTATAAATTCA GTGTTTGCCCAACTCAAGGTTACTATCGTGTTGTCCTCA

TTGGAGTTGTGGTCAGATAAGAATAAGATTCCTACAGTTGGTGAAGCAGATGAATTATTGCATAAATTTCTAGAATGGAAGCAGGCCTACCTTACCCTAA

GACCTCATGATGTTGCATATCTATTCAT - UNI32513 - TTATAACGAGTACCCAAATTACATGGGAGCAACGTATCCTGGGAAGATGTGTACTGCC

CACTACTCTGCAGGAATCACAATG - UNI32513 - TACCCCAAGGATATGACCTTGGAGGCCTTTTCGGTTATTCTCACCCAAATGCTGGGGCTCAG

TCTGGGGATATCGTATGATGAGCCTGAGAAATGCTACTGCTCGGAATCCATCTGCATCATGAATCCCAGGGCGAT - UNI32513 - GCAATATGGAG

GTGTGAAGTCATTTAGCAATTGCAGTTTGAATGACTTTGAACATTTTAAATCGAACGAGGGTGCCAAATGTCTGCAGAATAAGCCACAGATGCAAAGGAC

TGCAGCAGCGGTCTGCGGAAATGGCAAGGTGGAGGGTGATGAAATTTGTGACTGTGGCTCTGAAGCA GAATGTGGGCCTGATAGCTGTTGTGAACCTAA

CAGATGTGTTCTGAAAGCAGGAAGAGCTTGTGACAGTAAGTCTCCCTCATCAACATGCTGCAAAAATTGTCAA TTTTTACCAGAAAAACATCAATGTAG

GCCGGAAAAGCATCTATACTGTGACATTCCTGAAGTCTGCAATGGGAGCTCAGGAAATTGTCCACCTGATGTAACTATAAACAATGGGCATGTTTGCAAA

GAAAGCGGGACTATCTGTTATAATGGAGACTGTCCGGACCTGGACAGGGTGTGCGAGTCAATATATGGAGCAG GTTCAGTGAATGCTCCATTTGCCTGC

TATGAAGAAATCCAGGGCCAAAATGATAGGTTTGGCAACTGTGGCAAAGACAACCGAAACAGATATGTGTTCTGTGGATGGAG GAATCTCATATGTGGG

AGATTGATTTGTACGTACCCTACCCGAATGCCTTACAACCCACCCAATAACAGTACAGCTTCTGTGATCTATGCTTTTGTGCGAGACAAAGTGTGTATAA

CTGTGGACTTTGGATCGAGTGTCAAAGAAGATCCACTCAGGGTTGCTAATGGTGCTACATGTGATCTTGATAGG ATCTGCTTAAATGGCGTGTGCGTAG

AATCGAGATTTCTTAGGGATCAATCAAAAACGTGTTCATCCAAGTGCCACGGGAACGGA GTGTGCAATTCTCATGGTGTCTGCCACTGCAATGCCGGCT

ACTCACCTCCCAACTGTCAATATCCTACGACAAAAAGGTCAGCATCGCTGTGGTCTGGCAAGCACG - UNI36459 - ATCTGCCCATGGAAAGAGCA

TCTAAGAACCAAGAAAAGAAGTGGCTTTTAAGTTTGTACATTGTCTTAATTATCCTCGCTTCAGTGTTCCTCATAGGCACAGGGTGGAAAGGCTTGAAAC

AGTGCGGTTCCAAGGAAGAGGAGTCCATGAGTAGCGA - UNI36459 - AAGCAAATCAGAAGACAGCACTTACACGTATGTCAGCAG - UNI3381

3 - - UNI36459 - ATCAACTTCTGAGACAAGCAGTATGACATCTACGAGCAG - UNI28499 - - UNI33813 - TTAATTGCTACCCCTTC

ATCATCAGCAGCAGCAGCAACAGGAGGAAGAGGAAGAGGAAGAAGGGGAGGAGGAGGAGGAGAAGGAAGATGGCACCCAGGGGCTCACTGAGAAATGAAG

AGTCCACGTTCTTCCCTTGGTCACAGCTAAAAGGAGCCAATAAACCAAAAGTGGACCAA
Translation
MLGAMLHTLLLLLLAELGALLASGPE ESQSSFLEIIFPEKIEDKTHSE EQISYIIPINKKQYTVHLQKR - UNI32373 - RYFLTNRFMVYMYNQ

GSTSFHSPNIP - UNI32373 - - UNI34176 - AQCYYQGHIKGYPNSVATLSTCSGLR - UNI32373 - - UNI34176 - RGFLQFENV

SYGIEPLQSAFTSQHIVYKLGNKEKELIFNKNSRNIEMPTNYGILINKK - UNI34176 - PKSPFKNLFPLYLEMSIVVDKAL YDYLGSDSNIVTN

KIIEIISLINS VFAQLKVTIVLSSLELWSDKNKIPTVGEADELLHKFLEWKQAYLTLRPHDVAYLFI - UNI32513 - IYNEYPNYMGATYPGKMC

TAHYSAGITM - UNI32513 - YPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAM - UNI32513 - MQYGGVKSFSNCSLND

FEHFKSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEICDCGSEA ECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQ FLPEKHQCRPEKHLYCDIP

EVCNGSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDRVCESIYGAG GSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWR RNLICGRLICTYP

TRMPYNPPNNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVANGATCDLDR ICLNGVCVESRFLRDQSKTCSSKCHGNG VCNSHGVCHCNAGYSPPNC

QYPTTKRSASLWSGKHD - UNI36459 - DLPMERASKNQEKKWLLSLYIVLIILASVFLIGTGWKGLKQCGSKEEESMSSE - UNI36459 - ES

KSEDSTYTYVSR - UNI33813 - - UNI36459 - RSTSETSSMTSTSS - UNI28499 - - UNI33813 - S

For any suggestions or comments, please send an email to unitrap@crg.es